[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:purL"

purL        "phosphoribosylformylglycinamidine synthase"
            ""

OrgPattern --11--112222222--1211122111122112221222222221122-2111222222-2222--11 1121221222222222222-22112122222222222222221122221222222221112222222122211111111111-1222211111111---11111131121---------------11211211-122222222222222222211222222222222222221212221212222211111-222222222222222221222222222222222222222222222222222222222222222-22222-2-2222221111122221111111111111111111111111111111111111111111122111111111111111111111111112111211222-2-222222211112211122222222222212222122222222222-2121-11-2121222-1121112211222121111112211111111111122122222222222---------------222222222111111111111111111111111111111111111111111-11111111111211111111111111111222112222222222222222222-111112222222222222-1-------21212111111111111111111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--1111111222211111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111------------2-----------------------------2-112111212 ----111-----11111121111111111112111111111111121111111111111111111111-11111111-2111111111-12111121111131111-13-31-1111111111121111181112211-11111-1111111-11--111-1151-1311211121111A1111131221111121211 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MITIFEGLSALSPFKREKILAAAKKISNKVESVSAQYIHVTELESELNSEQERIVKSLLN:Sequence :EEEEEEEEEcccHHHHHHHHHHHHTTTccccEEEEEEEEEEEEcccccHHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|1->150|1t3tA3|1e-36|38.0|150/152|d.284.1.2 : =========================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 61: . . . * . .: 120 :YNREYGIAQPMGHTFIIAPRVGTISPWSSKATDIIKNTGIKAVKRIERAILFGVEGQVSA:Sequence :ccccccccccccEEEEEEEcTTcccHHHHHHHHHHHHTTcTTEEEEEEEEEEEEEcTccH:Sec Str :============================================================:RP:SCP|1->150|1t3tA3|1e-36|38.0|150/152|d.284.1.2 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 : $$$$$$$:RP:PFM|114->270|PF03962|2e-04|26.9|145/188|Mnd1 121: . . + . . .: 180 :SELKQIQDIVHDRMVEEVFSCKDDLYRLFSVTAPKELEFVNVLEKGAQAIKEADRKLGLA:Sequence :HHHHHHHHTTccTTTEEEEccGGGGGGGGccccccccccccHHHHTTccGGGcccccccc:Sec Str :============================== :RP:SCP|1->150|1t3tA3|1e-36|38.0|150/152|d.284.1.2 : ===========================:RP:SCP|154->219|1t3tA1|8e-25|62.1|66/68|a.5.10.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|114->270|PF03962|2e-04|26.9|145/188|Mnd1 181: . * . . . .: 240 :LSEQEIEYLADEYTKLGRNPTDTELYMFAQANSEHCRHKIFNAKWTIDGQEQDKSLFKMI:Sequence :cccccccTHHHHHHHHcccccHHHHHHHHHHTccccccTTTHHHHHHccTcccHccTTTT:Sec Str :======================================= :RP:SCP|154->219|1t3tA1|8e-25|62.1|66/68|a.5.10.1 : =====================:RP:SCP|220->429|1t3tA4|3e-97|67.0|209/209|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|114->270|PF03962|2e-04|26.9|145/188|Mnd1 241: + . . . . *: 300 :RNTTEKSPQGVLSAYKDNAAVIEGATAQRFYPNTQTGVYSFNQEEVDILMKVETHNHPTA:Sequence :TTTTGGGccTccccccccTTEEEccccEEEEEEEEEHHETTEEEEEEEEEEEEEccHHHH:Sec Str :============================================================:RP:SCP|220->429|1t3tA4|3e-97|67.0|209/209|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|114->270|PF03962|2e-04|26.9|145/188|Mnd1 : $$$$$$$$$$:RP:PFM|291->342|PF00586|5e-14|68.0|50/97|AIRS 301: . . . . + .: 360 :IAPFSGSATGVGGEIRDEGATGLGAKPKAGLTGFTVSNLNIPGFEQAWETSKYGKPNHIV:Sequence :HccHHHHHHHHHHHHHHHHTTTGTcEEEEEEEEEEEccccHHHHHHHHHcc cccHHHHH:Sec Str :============================================================:RP:SCP|220->429|1t3tA4|3e-97|67.0|209/209|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|291->342|PF00586|5e-14|68.0|50/97|AIRS 361: . . . * . .: 420 :TPLQIMLEAPIGGAHYSNEFGRPNLNGYFRTYEQEVNTSAGKEMFGYHKPIMIAGGMANI:Sequence :HHcHHHHHHHHHHHHHHGGGTccEEEEEEEEcTTcccEEEccTTccTTccEEEEEEEEEE:Sec Str :============================================================:RP:SCP|220->429|1t3tA4|3e-97|67.0|209/209|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 421: . . + . . .: 480 :KRMHVEKGDIKVGAKLICLGGPAMRIGLGGGAASSVVSSDTNSELDFASVQRDNAEMERR:Sequence :EGGGccccccccccEEEEEEccccccTTccHHHHHHHHHcccccccccccccccHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|447->459|glgggaassvvss :========= :RP:SCP|220->429|1t3tA4|3e-97|67.0|209/209|d.79.4.1 : ===================================================:RP:SCP|430->616|1t3tA6|6e-57|68.5|168/168|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 481: . * . . . .: 540 :CQEVIDRCWQMGENNPITFIHDVGAGGISNAFPELVKDGGGGGYFELRKVNVGEEGLSPL:Sequence :HHHHHHHHHHHHHTTcccEEEEccccTHHHHHTHHHHTTTcEEEEEGGGcccccTTccHH:Sec Str :============================================================:RP:SCP|430->616|1t3tA6|6e-57|68.5|168/168|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|502->588|PF02769|1e-05|28.7|87/148|AIRS_C 541: + . . . . *: 600 :EIWSNESQERYVLSVDPESLELFEQLCNRERCPFAVVGEAISEKHITLNDEYFDNKPVDL:Sequence :HHHccccccEEEEEEcTTccTTHHHHHHHTTcEEEEEEEEEcccEEEEcTEETTEEEEEE:Sec Str :============================================================:RP:SCP|430->616|1t3tA6|6e-57|68.5|168/168|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|502->588|PF02769|1e-05|28.7|87/148|AIRS_C 601: . . . . + .: 660 :PMGLLFGNTPQMHIDVKTVKVEQQAFDTSAIKLDEAIERVLKVPAVASKSFLITIGDRSI:Sequence :ETHHHHcccccccccTTEEcccccccccTTcccccccccccccccccccHHHHTTccccT:Sec Str :================ :RP:SCP|430->616|1t3tA6|6e-57|68.5|168/168|d.139.1.1 : ============================================:RP:SCP|617->816|1t3tA5|2e-43|57.5|200/200|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 661: . . . * . .: 720 :TGMVARDQMVGPWQVPVADCAVTTATVDSQAGEAMAMGERTPVAAINAAASGRLAIAETV:Sequence :TcHHHHHHHHcccccTTcccEEcEEccTTccEEEEEEEccHHHHHHcTTHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|617->816|1t3tA5|2e-43|57.5|200/200|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 721: . . + . . .: 780 :TNLLAADIEKLSDIRLSANWMVAANQGDENQKLYETVRAVGMEFAPALGIAIPVGKDSMS:Sequence :HHHHTTTcEEEEEEEccEEcccTTTcHHHHHHHHHHHHHHHHHHHHHccccEEEcccccc:Sec Str :============================================================:RP:SCP|617->816|1t3tA5|2e-43|57.5|200/200|d.79.4.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 781: . * . . . .: 840 :MKTKWSDNGQAKSVTSPLSLVISGFSPVTNARKTLTPVLVDDNDTTLLHIDLSNGAGRLG:Sequence :cEETTEccccEEEEEcccEEcEEEEEEEEEEEEcTTcccccccEEEEEEEEccccGGGcH:Sec Str :==================================== :RP:SCP|617->816|1t3tA5|2e-43|57.5|200/200|d.79.4.1 : ==============:RP:SCP|827->1029|1t3tA7|4e-37|41.9|203/217|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 841: + . . . . *: 900 :ASCLAQAYNQVGNVAPDIEASKVKVLFENITKLKAENKILAYHDVSDGGVFATLAEMSFA:Sequence :HHHHHTTcccccHHHHHHHHHHHHcccccHHHHHHHHHTTTcEEEccTTcccHHHHHHHH:Sec Str :============================================================:RP:SCP|827->1029|1t3tA7|4e-37|41.9|203/217|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 901: . . . . + .: 960 :GRKGLDVKLQTQDVLAKLFAEEVGVVIQVRNSDVSLVEEMFKDTQIHLCAIAKLNSSDEL:Sequence :TTcEEEEccccccEEEEEEEcccccccEEcTTcccTTccEEETTTccccEEEEEEccccE:Sec Str :============================================================:RP:SCP|827->1029|1t3tA7|4e-37|41.9|203/217|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 961: . . . * . .:1020 :NIFANGEKTYSNTRVNLQRWWAETSYQIQSIRDNSECAKQEFDSILNTNDKGIHVEATFD:Sequence :EEEETTEEEEEEccTTcccHHHHHHHHHcEEEEEEccTTTHHHHHHccccHHHHTTccEE:Sec Str :============================================================:RP:SCP|827->1029|1t3tA7|4e-37|41.9|203/217|d.139.1.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 1021: . . + . . .:1080 :LEEDITAKFVNVEKPKVTILREQGVNGQVEMAAAFTTAGFEAHDVHMSDLHAGRVTLADF:Sequence :ccccccccEHTTcccEEEEEccTTEEEHHHHHHHHHTTTcEEEEEcTTcHETTEEccccc:Sec Str :========= :RP:SCP|827->1029|1t3tA7|4e-37|41.9|203/217|d.139.1.1 : ================================================:RP:SCP|1033->1290|1t3tA2|4e-41|58.5|258/262|c.23.16.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 1081: . * . . . .:1140 :KVLVACGGFSYGDVLGAGGGWAKNILFTEKLRDEFSRFFGRDDTLALGVCNGCQMLAQLK:Sequence :cEEEEcEEcGGGGcccTTHHHHTHcHHHcTTHHHHHHHHHHTccEEEEcHHHHHHHHHEE:Sec Str :============================================================:RP:SCP|1033->1290|1t3tA2|4e-41|58.5|258/262|c.23.16.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 1141: + . . . . *:1200 :SLIKGAENWPIFIKNKSEQFEARVSMVEIQESDSIWFADMACTKAPIAVAHGEGRPLFEN:Sequence :EccccTccccEEEccccccccccEEEEEEcccccTTcTTccTTTcEEEEEcEEccccTTc:Sec Str :============================================================:RP:SCP|1033->1290|1t3tA2|4e-41|58.5|258/262|c.23.16.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 1201: . . . . + .:1260 :DNQQQAMLASAQVALKYIDGQGQATEMYPYNPNGAVNGLTAVTALDGRVLAMMPHPERVY:Sequence :TTcEEEEEccccccEEEcccccEEEEEEcccccccGGGEEEEEcccccEEEEccccTTTT:Sec Str :============================================================:RP:SCP|1033->1290|1t3tA2|4e-41|58.5|258/262|c.23.16.1 :============================================================:BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295 1261: . . . * . .:1320 :RAITNSHIPAEYDEYSVWMRMFRNARKWVG :Sequence :cTTTTccTcHHHHHHHHTcHHHHHHHHHcc :Sec Str :============================== :RP:SCP|1033->1290|1t3tA2|4e-41|58.5|258/262|c.23.16.1 :============================== :BL:SWS|4->1290|PUR4_PHOLL|0.0|56.6|1286/1295