[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:pyrD"

pyrD        "diyroorotate dehydrogenase"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111---------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQNQDLKRIIISPPFGKYLKFKETSNVYGSFTVNRRWGLIKQAIKTIRKIDKNAWRNKIG:Sequence : cTTEEEEEEETTcHHHHHHHHHHGGEEEEccccccTTccHHHHHHHHHHccTTHH:Sec Str : ====================================================:BL:SWS|9->246|PYRD_THEP1|2e-06|29.4|228/270 61: . . . * . .: 120 :LRNPGLANTNPPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVD:Sequence :HHHHHHHHTTccccEEEEEcHHHHHHHcHHHHHHHHHHHHHHHHTccEEEETTccHHHHH:Sec Str : =======================================:RP:SCP|82->242|1gt8A2|1e-08|17.4|155/310|c.1.4.1 :============================================================:BL:SWS|9->246|PYRD_THEP1|2e-06|29.4|228/270 121: . . + . . .: 180 :FPAELAPLFEDRNISIKMPPTVDHNAKIREYLAVGITTFHLCNTIPTAKGGISGYPLHKY:Sequence :HHHHHHHHHTcEEEEEEcTTccHHHHHHHHHHcccEEEEEcEEEccTTcTTcccccccHH:Sec Str :============================================================:RP:SCP|82->242|1gt8A2|1e-08|17.4|155/310|c.1.4.1 :============================================================:BL:SWS|9->246|PYRD_THEP1|2e-06|29.4|228/270 181: . * . . . .: 240 :SLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMFNPIRGKKLVKEI:Sequence :HHHHHHHHHTTcccTccEEEEcccccHHHHHHHHHTTccEEEEHHHHHHHHHGGGcHHHH:Sec Str : XXXXXXXXX :SEG|196->204|itiiggggi : ##################### :PROS|198->218|PS00912|DHODEHASE_2|PDOC00708| :============================================================:RP:SCP|82->242|1gt8A2|1e-08|17.4|155/310|c.1.4.1 :============================================================:BL:SWS|9->246|PYRD_THEP1|2e-06|29.4|228/270 241: + . . . . *: 300 :VKFWLDDF :Sequence :HHHHHHH :Sec Str :== :RP:SCP|82->242|1gt8A2|1e-08|17.4|155/310|c.1.4.1 :====== :BL:SWS|9->246|PYRD_THEP1|2e-06|29.4|228/270