[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:pyrH"

pyrH        "uridylate kinase"
PYRH_FRATW  "RecName: Full=Uridylate kinase;         Short=UK;         EC=2.7.4.22;AltName: Full=Uridine monophosphate kinase;         Short=UMP kinase;         Short=UMPK;"

OrgPattern -------1-------1----------------1111111111111--1----1--------1-11--- 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122222222122222211111122211111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111122111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111----------111111-11111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1119111112235-32--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALV:Sequence : cGGGGccTTcccccHHHHHHHHHHHHHHHTTTcEEEEE:Sec Str : XXXXXXXXXXXX :SEG|11->22|klpklkrillkl : ======================================:RP:SCP|23->247|1ybdA1|2e-61|42.3|222/236|c.73.1.3 :============================================================:BL:SWS|1->249|PYRH_FRATW|e-131|100.0|249/249 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->224|PF00696|4e-13|39.3|178/244|AA_kinase 61: . . . * . .: 120 :VGGGNILRGGRANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGL:Sequence :EccTTTcccHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHTTccEEEEEccccTTT:Sec Str :============================================================:RP:SCP|23->247|1ybdA1|2e-61|42.3|222/236|c.73.1.3 :============================================================:BL:SWS|1->249|PYRH_FRATW|e-131|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->224|PF00696|4e-13|39.3|178/244|AA_kinase 121: . . + . . .: 180 :LKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDK:Sequence :cEEccHHHHHHHHHTTcEEEEEcTTccccccHHHHHHHHHHHTTccEEEEEEcccccccc:Sec Str :============================================================:RP:SCP|23->247|1ybdA1|2e-61|42.3|222/236|c.73.1.3 :============================================================:BL:SWS|1->249|PYRH_FRATW|e-131|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->224|PF00696|4e-13|39.3|178/244|AA_kinase 181: . * . . . .: 240 :DPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS:Sequence :cccTTTccccccEEcHHHHHHTTcccccHHHHHHHHHHTccEEEEETTcTTHHHHHHTcc:Sec Str :============================================================:RP:SCP|23->247|1ybdA1|2e-61|42.3|222/236|c.73.1.3 :============================================================:BL:SWS|1->249|PYRH_FRATW|e-131|100.0|249/249 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->224|PF00696|4e-13|39.3|178/244|AA_kinase 241: + . . . . *: 300 :KYGTWVTLD :Sequence :cccEEEcEE :Sec Str :======= :RP:SCP|23->247|1ybdA1|2e-61|42.3|222/236|c.73.1.3 :========= :BL:SWS|1->249|PYRH_FRATW|e-131|100.0|249/249