[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31359.1 ftul2 pyrH "uridylate kinase"
MSNDSSECSQKLPKLKRILLKLSGESLSADQGFGINVESAQPIINQIKTLTNFGVELALV
VGGGNILRGGRANFGNKIRRATADSMGMIATMINALALRDMLISEGVDAEVFSAKGVDGL
LKVASAHEFNQELAKGRVLIFAGGTGNPFVTTDTTASLRAVEIGADALLKATTVNGVYDK
DPNKYSDAKRFDKVTFSEVVSKELNVMDLGAFTQCRDFGIPIYVFDLTQPNALVDAVLDS
KYGTWVTLD
//