[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rnc"

rnc         "ribonuclease III"
RNC_FRATM   "RecName: Full=Ribonuclease 3;         EC=3.1.26.3;AltName: Full=Ribonuclease III;         Short=RNase III;"

OrgPattern --------------------------------1-----111111--21-------------------- 1111111111111111111-11111111111111111111111111111111111111111111-1-111111111111111111111111111111--111111111111111111111111111111111111111111111111121332111111111122-12222111111111111-----11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11--1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111112111111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111-11111111111--111111111111111-111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111-11111111111111111111111111111111 ----311-----22322--12112121111111111111111111121-1-1----11-112-11111--22111111111111-121--112211-----2-111---241-12242111221331616J4142712223123-22211411623222132212223235233-1-------2-3655-43--1-121 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---

Master   AminoSeq   


1: . . . . + .: 60 :MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTKKNYERLEFLGDSVLSFVIAEVLYKQFT:Sequence :HTTTHHHHHHHHTcccccHHHHHHHHccTTccccccHHHHHHHHHHHHHHHHHHHHHcTT:Sec Str : ######### :PROS|37->45|PS00517|RNASE_3_1|PDOC00448| : =======================================================:RP:SCP|6->147|1o0wA1|6e-39|35.9|142/169|a.149.1.1 :============================================================:BL:SWS|1->230|RNC_FRATM|e-126|100.0|230/230 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->124|PF00636|5e-18|50.0|88/93|Ribonuclease_3 61: . . . * . .: 120 :DLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASEQGGHKREKILEDVFEAVIGAI:Sequence :cccHHHHHHHHHHHccHHHHHHHHHHTTGGGTcccccHHHcccccccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|6->147|1o0wA1|6e-39|35.9|142/169|a.149.1.1 :============================================================:BL:SWS|1->230|RNC_FRATM|e-126|100.0|230/230 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|37->124|PF00636|5e-18|50.0|88/93|Ribonuclease_3 121: . . + . . .: 180 :YLDSDFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGK:Sequence :HHTTcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcTTTEEEcccEEcEcTTccEE:Sec Str :=========================== :RP:SCP|6->147|1o0wA1|6e-39|35.9|142/169|a.149.1.1 : ================================================:RP:SCP|133->230|1whnA|3e-14|17.4|92/128|d.50.1.1 :============================================================:BL:SWS|1->230|RNC_FRATM|e-126|100.0|230/230 :$$$$ :RP:PFM|37->124|PF00636|5e-18|50.0|88/93|Ribonuclease_3 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|155->221|PF00035|2e-05|44.4|63/66|dsrm 181: . * . . . .: 240 :DHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMIEMLSQQGLHEKK :Sequence :cTTccEEEEEEEETTTEEEEEEEccHHHHHHHHHHHHHHHHHcccccccc :Sec Str :================================================== :RP:SCP|133->230|1whnA|3e-14|17.4|92/128|d.50.1.1 :================================================== :BL:SWS|1->230|RNC_FRATM|e-126|100.0|230/230 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|155->221|PF00035|2e-05|44.4|63/66|dsrm