[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rnd"

rnd         "ribonuclease D"
            ""

OrgPattern -------------------------------------------------------------------- ---1---1111-----------------------------------------------11------------------1111----------------------------------------------------------------111-1111-----1--1-11-11111-11111-11-1-----------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------1-1111111211111111111111111111111111-11111111111-111111111111112211111111111111111111112111122222111111122222222222222222111111------------------------------------------------------------------------1111----------11111111111111-11---------------------------111111111111111111111111111111--1---1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11---------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-222222----------------------------------------------111 --11112-211-11111111111-111111111111111111111111111-1-111111111111111111111-111111111111-1111--111111-1111-2112221212111-11132121292-21311--1-121111111-121111111112-7111121211--1-711122212313221-1111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIINTNKQLNNVIEILKNTSQIAVDTEFYWMRTYYPELCLVQLATENEIFLIDTLKDLEF:Sequence : EcccccEEcccccGGGcccEEEEEEEccccccTTccccEEEEEETTEEEEEcHHHHHHc:Sec Str : ===========================================================:RP:SCP|2->180|1yt3A3|2e-28|30.2|179/193|c.55.3.5 : ===========================================================:BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->164|PF01612|5e-19|33.3|162/171|3_5_exonuc 61: . . . * . .: 120 :KKLKEIFEDKDILKIIHSATNDIPIIKRFFNCEVNNIFDTQLAATFLGFQTQSSLKTLLK:Sequence :HHHHHHHHcTTcEEEEccHHHHHHHHHTTTcccccEEEEHHHHHHHHcTTcccccHHHHH:Sec Str : XXXXXX:SEG|115->130|lktllkeildieieke :============================================================:RP:SCP|2->180|1yt3A3|2e-28|30.2|179/193|c.55.3.5 :============================================================:BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->164|PF01612|5e-19|33.3|162/171|3_5_exonuc 121: . . + . . .: 180 :EILDIEIEKESQFSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKSEYQDFFEQEL:Sequence :HTTTccccccHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcHHHHHHTH:Sec Str :XXXXXXXXXX :SEG|115->130|lktllkeildieieke :============================================================:RP:SCP|2->180|1yt3A3|2e-28|30.2|179/193|c.55.3.5 :============================================================:BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->164|PF01612|5e-19|33.3|162/171|3_5_exonuc 181: . * . . . .: 240 :IEVQKTQFNSIENIHAKIGNIQKFDEKTQRNAILIAQWRETIAQEKNIPVRFIFNNKILY:Sequence :HHHHHHHHHHHHcEEEcHHHHHHHHHHHHHHHHHHHHHHHHHTTccccTTcHHHHHHHHH:Sec Str : =================================================:RP:SCP|192->254|1yt3A1|4e-09|25.4|63/101|a.60.8.3 :============================================================:BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 241: + . . . . *: 300 :TIAHINPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLDQVTLEQTSGSKLSTELNDKI:Sequence :TTTcccccccccHHHHHHHGGGcHHHHHHHHHHHHHHHHHHHTHHHHTTccTTTcEEccE:Sec Str :============== :RP:SCP|192->254|1yt3A1|4e-09|25.4|63/101|a.60.8.3 : ===:RP:SCP|298->359|1yt3A2|1e-08|21.0|62/81|a.60.8.3 :============================================================:BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 301: . . . . + .: 360 :IDFFDTYTKQLKFDSSIIASRKDIRSLAYNLNIDTNYKNNKLLNGWRYEIVGKKLKEYIL:Sequence :EEcccccccccEccHHHHccHHHHHHH HHHHTTccccccGGGcHHHHHHHHHHH :Sec Str :=========================================================== :RP:SCP|298->359|1yt3A2|1e-08|21.0|62/81|a.60.8.3 :======================================================= :BL:SWS|2->355|RND_HAEIN|4e-31|28.5|344/399 361: . . . * . .: 420 :SNTK :Sequence : :Sec Str