[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rpmD"

rpmD        "50S ribosomal protein L30"
RL30_FRATW  "RecName: Full=50S ribosomal protein L30;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111--111111------------------1------1--------------------------------------------------------------------------------------11----------------------------------------11111111111111111111111111111111111111111111111111111111111-11111111111-1----------------1----1---------------------------------111111111111111111111111111111-1--1-111--1---11111111111111-11-1111111111111111111111111111111111111111111111111111-1111111--111--1111111111-1111-1111-11111111111111111111111111111111111111111111111111111111111111111--1--1-1---111--------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTQAKTFKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMVKIE:Sequence : ccEEEEEEccccTTccHHHHHHHHHHTcccTTcEEEEEccHHHHHHHHHTTTTEEEE:Sec Str : =======================================================:RP:SCP|6->60|1bxyA|3e-14|38.2|55/60|d.59.1.1 :============================================================:BL:SWS|1->61|RL30_FRATW|6e-31|100.0|61/61 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|8->57|PF00327|6e-06|50.0|50/52|Ribosomal_L30 61: . . . * . .: 120 :G :Sequence : :Sec Str := :BL:SWS|1->61|RL30_FRATW|6e-31|100.0|61/61