[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD31331.1 ftul2 rpmD "50S ribosomal protein L30"
MTQAKTFKVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMVKIE
G
//