[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rpoC"

rpoC        "DNA-directed RNA polymerase, beta' subunit"
RPOC_FRATM  "RecName: Full=DNA-directed RNA polymerase subunit beta';         Short=RNAP subunit beta';         EC=2.7.7.6;AltName: Full=Transcriptase subunit beta';AltName: Full=RNA polymerase subunit beta';"

OrgPattern 11111111111111111111111111111111112111111111112111111111111111111111 1111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222222222222222222222222222222222222111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111--1-1111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 35233313934233333232333333333222333333333333333333333233333333233333133233222-2233333233-34332323333333334335462533233313333562324J3-3453323333222323242153123235L633G3323G33634373W333-595293582253334 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--

Master   AminoSeq   


1: . . . . + .: 60 :MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIF:Sequence : ccccccccccccccEEcccccHHHHHHHcccccccccccccTTcccccccccccccc:Sec Str : ================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 61: . . . * . .: 120 :GPIKDYECLCGKYKRLKHRGVVCERCGVEVEQAKVRRERMGHIDLVCPVVHIWYLKSLPS:Sequence :cccccccccccccTTccTTcEEcccTTccccTTTTcccccEEEEEEEEEcccTTHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|79->91|rgvvcercgveve :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 121: . . + . . .: 180 :RIGLFLDMPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGA:Sequence :HEETTTTEEcccTTccHHHHHTTcccHHHHHHHHGGGTcccccccccccccccccccccc:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 181: . * . . . .: 240 :EAIRDLLADTDIESEIELLQAECEESKSTAKKEKAIKRLRLLETFQASGNKPEWMVMTVL:Sequence :cccccEEEEccccEEEEcccEEcHHHHHHHHHccccTHHHHHccccTTcccccccccccc:Sec Str : XXXXXXXXXXXXXXX :SEG|201->215|aeceeskstakkeka : XX:SEG|239->252|vlpvlppdlrplvp :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 241: + . . . . *: 300 :PVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKLLDLNAPDIIVRNEKRMLQEA:Sequence :ccccccGccccccccccccGGGTTTTTcHHHHHHHHTTTcccccccTHHHHHHHHHHHHH:Sec Str :XXXXXXXXXXXX :SEG|239->252|vlpvlppdlrplvp : XXXXXXXXXXXXXXXXX :SEG|268->284|rrvinrnnrlkklldln :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 301: . . . . + .: 360 :VDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPSLR:Sequence :HHHHTTccccccccccccccccccTTTTTTTccccccTTcccccccccEEEEEEEccccT:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->339|PF04997|2e-68|49.5|305/326|RNA_pol_Rpb1_1 : $$$$$$$$$$$$$$$$$$$:RP:PFM|342->484|PF00623|1e-35|51.0|143/166|RNA_pol_Rpb1_2 361: . . . * . .: 420 :LHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL:Sequence :TTcccccTTHHHHHHHHHHHHHHHHTcccccHHHHHHHTccccccHHTTHHHHTTTccEE:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|342->484|PF00623|1e-35|51.0|143/166|RNA_pol_Rpb1_2 421: . . + . . .: 480 :LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARV:Sequence :ccccccccGGGTcEEcccccccccEEEcTTTHHHHcccccccEEEEcccccGGGTTTTcc:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|342->484|PF00623|1e-35|51.0|143/166|RNA_pol_Rpb1_2 481: . * . . . .: 540 :LMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTI:Sequence :cccTTTcccccTTccccccccTTTHHHHHHTccccccccccccccccccHHHHHTTcccc:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$ :RP:PFM|342->484|PF00623|1e-35|51.0|143/166|RNA_pol_Rpb1_2 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|487->642|PF04983|2e-18|40.7|140/145|RNA_pol_Rpb1_3 541: + . . . . *: 600 :DIHAKIKLRIDRQVFDTKGNTYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEIS:Sequence :cccccccccccccccccccccccccccccccHHHHHHHHHHHHHTTcTTTTTTccccHHH:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|487->642|PF04983|2e-18|40.7|140/145|RNA_pol_Rpb1_3 601: . . . . + .: 660 :KIINQAFRVLGGKATVVLADKLMYAGFKYSTLSGVSVGVDDMTIPDNKEAKIEEAEKEIK:Sequence :HHHHHHHTTcTHHHHHHHHHHHHHHHHHHHHHHccccccTTTcccTTHHHHHHHTTTTTH:Sec Str : XXXXXXXXXXXXX:SEG|648->660|keakieeaekeik :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|487->642|PF04983|2e-18|40.7|140/145|RNA_pol_Rpb1_3 661: . . . * . .: 720 :QITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVY:Sequence :HHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccT:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|678->747|PF05000|1e-10|44.3|70/107|RNA_pol_Rpb1_4 721: . . + . . .: 780 :MMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYFTSTHGARKGL:Sequence :TTTTTcccccHHHHHHHcccccccccTTcccccccccTTccccTTcTTHHHHHHHHHHTT:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|678->747|PF05000|1e-10|44.3|70/107|RNA_pol_Rpb1_4 : $$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 781: . * . . . .: 840 :ADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT:Sequence :TGGGTTTTTcccTHHHHHHTTTTccccccccEccccEEEEEccEEcTTTccEEcccTTcc:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 841: + . . . . *: 900 :LAADVVTEKGVVLLEAGTLLDENLVELLDDNGIDMIKVRSPITCKTRRGLCAKCYGRDLA:Sequence :ccEEEHHccccccEEEccHHHHHHHHTTTcccccEEEEccccccccTTTcccccccccTT:Sec Str : XXXXXXXXXXXXX :SEG|859->871|lldenlvellddn :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 901: . . . . + .: 960 :RERQVNVGESVGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIR:Sequence :cccccccccccHHHHGGGGTTGGGccccccccccccccccccccHHHHHHHHTTcccccc:Sec Str :============================================================:RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 961: . . . * . .:1020 :TVTNKEGQEIVISRAGEIIVSDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHA:Sequence :ccccccccccccccccccccccccccccccccccccccccccccccccccccTccccccc:Sec Str :=========================================================== :RP:SCP|13->1019|2ghoD1|0.0|48.0|973/1196|e.29.1.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1021: . . + . . .:1080 :QPLITDVAGKVVLEDVIDGITSKHTYDDLTGQQTIEITSISQRTTSKNLKPVVKIVDEKG:Sequence :ccHHHHccHHHHHHHHHTccccTTcTHHHHHHHHTcEEEEcTTccHHHHHHHHccEETTT:Sec Str :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1081: . * . . . .:1140 :AKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKDITGGLPRVAELFEARRPKDA:Sequence :cccccccccccccccccccccccccccccccccccccTTTTTccHHHHTTHHHHTTcccE:Sec Str : ======:RP:SCP|1135->1205|1qwyA|7e-10|18.6|70/234|b.84.3.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1141: + . . . . *:1200 :AILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLAD:Sequence :EEcccccccccEEEEccTTcccEEEEEEccEEEcTTccEEEccEEEEEEccccHHHHTTc:Sec Str :============================================================:RP:SCP|1135->1205|1qwyA|7e-10|18.6|70/234|b.84.3.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1201: . . . . + .:1260 :GPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS:Sequence :TTccTTTcHHHHcHHHHHHHHHHHHHHHHccccccccTHHHHHHHHHTTTTccccccTTc:Sec Str :===== :RP:SCP|1135->1205|1qwyA|7e-10|18.6|70/234|b.84.3.2 :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1261: . . . * . .:1320 :KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVL:Sequence :EEEEcTTccccccccccccGGGccccEEEEEEccccTTTTTTTTccHHHHHcccccHHHH:Sec Str :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|763->1310|PF04998|2e-65|36.9|469/471|RNA_pol_Rpb1_5 1321: . . + . . .:1380 :TEASINSQIDNLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSS:Sequence :HHHHHTTcEEccccHHHHHHTTccccccTTcccc :Sec Str :============================================================:BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417 1381: . * . . . .:1440 :FNPEEISFDSIQSQKEDKDINEDIEESLRNALESLDF :Sequence : :Sec Str : XXXXXXXXXXXX :SEG|1395->1406|kedkdinediee :===================================== :BL:SWS|1->1417|RPOC_FRATM|0.0|100.0|1417/1417