[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30290.1 ftul2 rpoC "DNA-directed RNA polymerase, beta' subunit"
MNNGILHQNYNSKKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIF
GPIKDYECLCGKYKRLKHRGVVCERCGVEVEQAKVRRERMGHIDLVCPVVHIWYLKSLPS
RIGLFLDMPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTDEEYAEALENYGYEFEASMGA
EAIRDLLADTDIESEIELLQAECEESKSTAKKEKAIKRLRLLETFQASGNKPEWMVMTVL
PVLPPDLRPLVPIEGGRFATSDLNDLYRRVINRNNRLKKLLDLNAPDIIVRNEKRMLQEA
VDALLDNGRRGRAVTGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPSLR
LHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVL
LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARV
LMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTI
DIHAKIKLRIDRQVFDTKGNTYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEIS
KIINQAFRVLGGKATVVLADKLMYAGFKYSTLSGVSVGVDDMTIPDNKEAKIEEAEKEIK
QITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVY
MMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQYFTSTHGARKGL
ADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT
LAADVVTEKGVVLLEAGTLLDENLVELLDDNGIDMIKVRSPITCKTRRGLCAKCYGRDLA
RERQVNVGESVGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIR
TVTNKEGQEIVISRAGEIIVSDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHA
QPLITDVAGKVVLEDVIDGITSKHTYDDLTGQQTIEITSISQRTTSKNLKPVVKIVDEKG
AKLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKDITGGLPRVAELFEARRPKDA
AILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLAD
GPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDS
KFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGITRSSLSTESFLSAASFQETTRVL
TEASINSQIDNLRGLKENVLIGRLIPTGTGLAVRKESAKIEKMREELGVEDNMVFTDLSS
FNPEEISFDSIQSQKEDKDINEDIEESLRNALESLDF
//