[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rpoH"

rpoH        "RNA polymerase sigma-32 factor"
            ""

OrgPattern -------------------------------------------------------------------- 1123422222222233322-2222222222222232434333331111122212111111334253357741111111211372233311111111111111112211141111111111111111-1111111115555611154L68644456666668785545789657555557555522-1111254555555556455556545445655554425112222226411111111111111121111111211211111111111111111111111111111111111111111111111111111111111111155555555556546454554333545323324433553444535574112324222433333224222232223233333333333-33334333333232233333333322233333333333322222222222223432222222222222212222222222222222222222222555565344545544444434546454322333232222224324333222332222222223333222232222222222334433334556557231111111111111111111111111553333433333343333333333333333332-2533322222232333333333333333-33333232333333333333333333323333333333333333323323322333333333333223233333333322333222222222222222222222222233333333353333333332222222222444433333434332222222222222222341111112222222242111111--111111111-111-11112131111111231 -------1----------------------------------------------------------------------------------------------------2------------------------------------------------------------------3111B111126488-53651---3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANKKLLPATKTKTLPVVSDNNLSAYLNFVNTLPVLSLEQEQELARRYKYKKDLDAAQQL:Sequence : cTTTHHHHHHHHHHTccHHHHHHHHHHHccHHHHHHHHH:Sec Str : XXXXXXXXXXXXX :SEG|4->16|kkllpatktktlp : ===================================:RP:SCP|26->124|1sigA|7e-27|36.4|99/305|a.177.1.1 : ============================================:BL:SWS|17->288|RP32_HAEIN|1e-82|55.7|271/281 : $:RP:PFM|60->105|PF04542|2e-07|47.8|46/70|Sigma70_r2 61: . . . * . .: 120 :VLSHLRFVTKIARNFSGYGLSIADLIQEGNIGLMKAVSKFDPDQGVRLLSFAVHWIKAEM:Sequence :HHHTHHHHHHHHGGGccccccHHHHHHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHH:Sec Str : ############## :PROS|84->97|PS00715|SIGMA70_1|PDOC00592| :============================================================:RP:SCP|26->124|1sigA|7e-27|36.4|99/305|a.177.1.1 : =========:RP:SCP|112->184|2fug21|4e-13|17.5|63/178|c.47.1.21 :============================================================:BL:SWS|17->288|RP32_HAEIN|1e-82|55.7|271/281 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|60->105|PF04542|2e-07|47.8|46/70|Sigma70_r2 121: . . + . . .: 180 :HDYVLKNWKIVKVATTKAQRKLFFNLRSSKDKIGWLSSENIKELAEELGVKEETVIEMEK:Sequence :HHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHcTTccHHHHHHH:Sec Str :==== :RP:SCP|26->124|1sigA|7e-27|36.4|99/305|a.177.1.1 :============================================================:RP:SCP|112->184|2fug21|4e-13|17.5|63/178|c.47.1.21 : ====================:RP:SCP|161->202|1rp3A1|5e-04|23.8|42/77|a.4.13.1 :============================================================:BL:SWS|17->288|RP32_HAEIN|1e-82|55.7|271/281 181: . * . . . .: 240 :RMCQGDASLDLPYTDDDGEQTSQQSLYLEDKSSNIEHQVVQQDYYDNFKAIVKDVLSGFD:Sequence :HHTcccccTTcccEcTTcccccGGGTccccccccHHHHHHHHHHHHHEEEcHHHHHHccc:Sec Str :==== :RP:SCP|112->184|2fug21|4e-13|17.5|63/178|c.47.1.21 :====================== :RP:SCP|161->202|1rp3A1|5e-04|23.8|42/77|a.4.13.1 : =========:RP:SCP|232->286|1ku3A|1e-08|34.5|55/61|a.4.13.2 :============================================================:BL:SWS|17->288|RP32_HAEIN|1e-82|55.7|271/281 241: + . . . . *: 300 :TRTKDIIMSRYLLDNKATLQDLAAKYNISAERVRQIEEDALAKLKKAIKNRS :Sequence :HHHHHHHHHHTTTTTTcHHHHHHHTTcccHHHHHHHHHHHHHHHHHHTTTc :Sec Str : ########################### :PROS|258->284|PS00716|SIGMA70_2|PDOC00592| :============================================== :RP:SCP|232->286|1ku3A|1e-08|34.5|55/61|a.4.13.2 :================================================ :BL:SWS|17->288|RP32_HAEIN|1e-82|55.7|271/281