[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:rpsF"

rpsF        "30S ribosomal protein S6"
RS6_FRATW   "RecName: Full=30S ribosomal protein S6;"

OrgPattern -------------------------------------------------------------------- --1--11----11----11-1-----11111-----1-111-1-----111-11111---11-1---111--------1---11-1111111--11--------1-1-----------------------------1-1------1-11---1------------1-11----------------------11-111111111111111-111--111111-1-1------11---------------1----------------------------------------------------------------------------1111111111111-1111111--111---11--111-1111111-1-----111111111111111111111111111111111-11111111111112-11111111111111111111111111111111-1111111------------1-11111111111-----11-1111111111111111111111111111111111111111111111111111111111111111111111111111--11-111111-1--1-1-11------1-----1-----------------11-111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1-11------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYV:Sequence :cEEEEEEEEEcTTccHHHHHHHHHHHHHHHTTTcEEEEEEEEEEEEEEEEETTEEEEEEE:Sec Str :============================================================:RP:SCP|1->100|1vs5F1|3e-27|58.0|100/100|d.58.14.1 :============================================================:BL:SWS|1->111|RS6_FRATW|1e-61|100.0|111/111 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->90|PF01250|5e-21|46.6|88/92|Ribosomal_S6 61: . . . * . .: 120 :LFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI :Sequence :EEEEEEcHHHHHHHHHHHHTcTTEEEEEEEEccccccccc :Sec Str :======================================== :RP:SCP|1->100|1vs5F1|3e-27|58.0|100/100|d.58.14.1 :=================================================== :BL:SWS|1->111|RS6_FRATW|1e-61|100.0|111/111 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->90|PF01250|5e-21|46.6|88/92|Ribosomal_S6