[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30829.1 ftul2 rpsF "30S ribosomal protein S6"
MKHYEVVLMIHPDQSDQLDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYV
LFNIECPTESLEKLQESLRYNDAILRRLVIATKEAITEPSVMMESNEKEVI
//