[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:tmk"

tmk         "thymidylate kinase"
KTHY_FRATM  "RecName: Full=Thymidylate kinase;         EC=2.7.4.9;AltName: Full=dTMP kinase;"

OrgPattern --1-1---111111221111111111111111-1-1111---11-1-111111-1111111--11--- 11111-----------------------------------111111111111111111111111---111111111111111111111--------------------1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1----------1---1------111--11--1111111111111--111111111112111111111111111111111111-11112111111111111111111111111111111111111111111111111-11111111111111111113111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111311----21111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111------------11111111-1----------15D421-111111111111111111111-1111111111 1----1--------111111-----1-1111-----------------1-------------------------------------1-----1-----------1------22--1---------------------------------------1--------13----------1-----------1-2-------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDE:Sequence :GEEEEEEEcccccccHHHHHHcccccEEEEcccHHHHHTTccccHHHHHHHHHHHHHHTc:Sec Str : ===========================================================:RP:SCP|2->203|1e2dA|1e-45|28.6|192/209|c.37.1.1 :============================================================:BL:SWS|1->209|KTHY_FRATM|e-118|100.0|209/209 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->195|PF02223|2e-39|42.2|185/188|Thymidylate_kin 61: . . . * . .: 120 :EIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRAL:Sequence :ccHHHHHHHHHHHHHHHHHGGGEEEEEEccccEEEEccTHHHHTHHHHTTcccHHHHHHH:Sec Str : ############# :PROS|94->106|PS01331|THYMIDYLATE_KINASE|PDOC01034| :============================================================:RP:SCP|2->203|1e2dA|1e-45|28.6|192/209|c.37.1.1 :============================================================:BL:SWS|1->209|KTHY_FRATM|e-118|100.0|209/209 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->195|PF02223|2e-39|42.2|185/188|Thymidylate_kin 121: . . + . . .: 180 :NDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDN:Sequence :HHTcccccTTcEEEEEEccHHHHHHHHHTTccTcTTccccHHHHHHHHHHHHHHHHHTTc:Sec Str :============================================================:RP:SCP|2->203|1e2dA|1e-45|28.6|192/209|c.37.1.1 :============================================================:BL:SWS|1->209|KTHY_FRATM|e-118|100.0|209/209 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->195|PF02223|2e-39|42.2|185/188|Thymidylate_kin 181: . * . . . .: 240 :AIEIDAAKSIQEVEKQIYLILDKHFNFQN :Sequence :cHHHHGccccTTccHHHHHHHHHHHH :Sec Str :======================= :RP:SCP|2->203|1e2dA|1e-45|28.6|192/209|c.37.1.1 :============================= :BL:SWS|1->209|KTHY_FRATM|e-118|100.0|209/209 :$$$$$$$$$$$$$$$ :RP:PFM|9->195|PF02223|2e-39|42.2|185/188|Thymidylate_kin