[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:trkH"

trkH        "K+ transporter (Trk) family protein"
            ""

OrgPattern 111-21-----------------12231132311111-111112-12-1322211111111------- --------------------------------------------------------------------------------111--1--2212-111-------11---1---------------------1----1-----111----1-------------------------------------11-------------------------------------------------------------------------------------------111----11111111111111-------------1--111----111--1111111-1----------111--11-122-1-111-----1-11-11----11111-------------11111111111---------1-1--11-------22112111112122111-------------21111111111-------------------111-----11111---------------------------------1-1111-------22----1111111111-11--1121111--1---1-----------1---1-----------------------111--221121121122222212222222222222---21-1------12122112111211211-112211111111112222211111111111111111111111-2111111111111111111111--11---------11222111111111111111----------1112311111121221111111111111112222222222222--------------111---------------1---------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMLSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFTVTFLCGFLLWFISRKS:Sequence : =====================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 61: . . . * . .: 120 :NKKLSNRDGFLIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFESVSGFTTTGGTVIEGL:Sequence : XXXXXXXX :SEG|108->115|gftttggt :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 121: . . + . . .: 180 :DKLPHSILFYRQQTEFFGGMGIIVLSVAILPLLGVGGMQLYKAEVSGQWKDDKIAPKISS:Sequence :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 181: . * . . . .: 240 :TAKALWMVYLLLTFLCFISYLLVGVEPFDAICYTFSTVSTGGFAPSDASMTDKPLGMLIV:Sequence :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->479|PF02386|7e-07|23.7|270/327|TrkH 241: + . . . . *: 300 :CAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFLFFTSFIVCITIITHTNDLSN:Sequence :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->479|PF02386|7e-07|23.7|270/327|TrkH 301: . . . . + .: 360 :IFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMFIAIIGGCGGSTAGGLKMIRA:Sequence : XXXXXXXXXXXXXX :SEG|341->354|iaiiggcggstagg :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->479|PF02386|7e-07|23.7|270/327|TrkH 361: . . . * . .: 420 :ILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFAGGWLALLGCG:Sequence : XXXXXXXXXXX:SEG|410->421|aggwlallgcgl :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->479|PF02386|7e-07|23.7|270/327|TrkH 421: . . + . . .: 480 :LDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPD:Sequence :X :SEG|410->421|aggwlallgcgl :============================================================:BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|204->479|PF02386|7e-07|23.7|270/327|TrkH 481: . * . . . .: 540 :FWRK :Sequence :==== :BL:SWS|8->484|TRKH_SHIFL|1e-90|38.6|474/483