[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30317.1 ftul2 trkH "K+ transporter (Trk) family protein"
MMLSQKPKIIGIFLMFLSLTMLSPLLVDYIYDEDNAYPFVLSFTVTFLCGFLLWFISRKS
NKKLSNRDGFLIVTLVWIFVTVFGAIPYMSFPGLNLSFTNAVFESVSGFTTTGGTVIEGL
DKLPHSILFYRQQTEFFGGMGIIVLSVAILPLLGVGGMQLYKAEVSGQWKDDKIAPKISS
TAKALWMVYLLLTFLCFISYLLVGVEPFDAICYTFSTVSTGGFAPSDASMTDKPLGMLIV
CAIFLFLGATSFKAHYIALSKFKISHYFRNIEFKAYFYFLFFTSFIVCITIITHTNDLSN
IFSIVTNSIFQVISISSSAGFVSDNNYYLWPSFLPIMLMFIAIIGGCGGSTAGGLKMIRA
ILFKEKAILEARRVIHPQGVFTVKLGDIHISEQALNRVSGFISVYIIIFAGGWLALLGCG
LDIPTAFSTIATTLSNVGPGLGDIGSNFKNLPKEALWICNFAMIAGRLEIFTILVLFMPD
FWRK
//