[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:trpS"

trpS        "tryptophanyl-tRNA synthetase"
            ""

OrgPattern 11111--1-------11---1-1----------1-11-11111------------1-1--11---1-1 1111211111111111111-11111111111111111111112112111111111112112121212222112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112221111112122222122222222222111121211111111111111211111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111211111111111111111111111111111111111-11112111112121111111111111111111111111111111111111111111111111111211111111111111111111111111111222122222221121222212222111111111111111111111111111221111111111111111111111111111111111112111111111111111111111111111111111112211111111111111111111111111111-1111111111121112211111111111-11111111111111111112221111221222222222222222111111111111111111111111111111111111211111111111111111111111111111111111112111121111111111111211211111222111111111111111111111111111111111111111111-11111111111111111111111111111111 1---111-1---1111111-1-1-111111111111-11111111111111-1111111111111111111111111--111111111-1111111---1111111--2121-1112111111121111292-112111111111111111111-121112511111111512221111I111-111211311121112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSQKIILTGVTPSGTPHLGNYIGAIKPAIEMIKNDQYKCMYFIADQHSLIKLWDKKLRQQ:Sequence :cccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHTccEEEEEcHHHHHHccccHHHHHH:Sec Str : ########## :PROS|12->21|PS00178|AA_TRNA_LIGASE_I|PDOC00161| : =========================================================:RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 : =======================================================:BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b 61: . . . * . .: 120 :YIYEIAASWLALGLDPDKAYFYRQSDIPEIMELTWIISTTTAKGLLNRAHAYKALVDQNL:Sequence :HHHHHHHHHHTTTccTTcEEEEEHHHHHHHTTccHHHHHHHHHHHTccHHHHHHHHcccc:Sec Str :============================================================:RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 :============================================================:BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b 121: . . + . . .: 180 :QEENADPDKGITMGLFNYPVLMAADILIFDADLVPVGKDQIQHIEIARDIANRFNHIYQK:Sequence :ccHHTTccTTccHHHHTHHHHHHGGGcGGGcHEEEEEGGGHHHHHHHHHHHHHTTccccE:Sec Str :============================================================:RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 :============================================================:BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b 181: . * . . . .: 240 :PVLKAPQALTSEDSQTILGLDGRKMSKSYDNTIAIFSMEKKLRKQVMKIITNSQMPEEKK:Sequence :EEEcccEEEEEcccccTTcccccccTTcGGGcccTTccHHHHHHHHHHHcccccccHHHH:Sec Str :============================================================:RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 :============================================================:BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b 241: + . . . . *: 300 :DPNNCTIFAIYKSIASQTEIAALEEKYLAGGLGWGDAKQILFEKINEYLRDAREKYDYYI:Sequence :HcccTTTcHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHTcc:Sec Str :============================================================:RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 :============================================================:BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->287|PF00579|7e-40|40.0|265/279|tRNA-synt_1b 301: . . . . + .: 360 :NNPKIVDDILNQGAAKVRPLAKDKLKEVKDIIGM :Sequence :HHHHHHHTcccccccHHHHHHHHHHHHHHHHHTc :Sec Str :================================== :RP:SCP|4->334|1d2rA|2e-34|32.5|317/326|c.26.1.1 :================================== :BL:SWS|6->334|SYW_PSEAE|7e-97|52.6|327/448