[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "ftul2:wbtG"

wbtG        "glycosyl transferase"
            ""

OrgPattern ----------------1------------1----------1---1-3----22------2-------- ----------------------------------------------------------------------------------------11---1---------2---1-------------------1------------------1----------------------2-----1-1-1---------12-----1-1-1-1--12----------1---1---------1----1-11-11---111----------------1-----1-----------------1--------------------------1------1----2221111-1-11--12----2-----1---3---------21----11----------------------------------------------------1---1----------------------------------------------------------------1--11111-------------1----------1-----------------------1-----------111----21-1-----------11-1--111-------11---1111------------111----1-1--111---------------1--------1--2----------1-------1-----------------------------1-------------------------------------------------------21----------------1---1-1--1-----1-------------111111111--121--------11----------------1---------------2---------------------------2--1121231--- --11----------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTLN:Sequence :cccEEcTTccTTcccHHHHHHHHHHHHHHTTcEEEEEEEcccGGGcEEEEETTEEEEEEc:Sec Str : XX:SEG|59->72|lnlnkfnvlfvlfk : ===============================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 : ============================= :BL:SWS|2->30|EPSF_BACSU|4e-04|51.7|29/384 61: . . . * . .: 120 :LNKFNVLFVLFKYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYD:Sequence :ccccccccGGGGGHHHHHTccccEEEEEcHHHHHHHHHHHHHHTccEEEEccccTTccTT:Sec Str :XXXXXXXXXXXX :SEG|59->72|lnlnkfnvlfvlfk :============================================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 : ===============================================:BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380 121: . . + . . .: 180 :GHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLK:Sequence :TccHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHcccGGGEEccccTTTcccccTT:Sec Str :============================================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 :============================================================:BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380 181: . * . . . .: 240 :YEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDI:Sequence :HHHHHHHTTccTTcEEEEEEccccGGGcHHHHHHHHHHHHHHcccccEEEEEEcccccHH:Sec Str :============================================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 :============================================================:BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380 241: + . . . . *: 300 :GSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVG:Sequence :HHHHHTTcTTTEEEEccccHHHHHHHHccEEEEccccccccHHHHHHHHTTccEEEEccT:Sec Str :============================================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 :============================================================:BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|262->342|PF00534|1e-07|33.8|80/165|Glycos_transf_1 301: . . . . + .: 360 :DCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSIEAILEKHEKL:Sequence :THHHHcccTTTEEEEccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 :============================================================:BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|262->342|PF00534|1e-07|33.8|80/165|Glycos_transf_1 361: . . . * . .: 420 :YHEGSV :Sequence :HHH :Sec Str :==== :RP:SCP|14->364|2iv7A1|6e-34|11.5|349/370|c.87.1.8 :== :BL:SWS|74->362|CAPM_STAAU|7e-16|25.1|283/380