[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACD30267.1 ftul2 tmk "thymidylate kinase"
MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDE
EIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRAL
NDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDN
AIEIDAAKSIQEVEKQIYLILDKHFNFQN
//