[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "halo0:phr1"

phr1        "photolyase/cryptochrome"
            ""

OrgPattern ------1111111111--------32233223-----------------1-----------1------ ---11-11111----11----1--11-----11111111111-12----1111111-1----1-1-11211-------------------------1----132212232--------------1---1-----1122322---1112212222222223222222322321--1122-21-2---111---1-1111111--111111----1-11------221111111--11111111111111-111-1-------------------11-------1-----------------1111111111111-------------------------------------------------------------11111-------1121--111111----------1----------111-111-1-111--1112132-1111211111111112111--11--------1--1--11-------------121-111----11111111111221111111111111111111-3111111-11-111-1221111-1111----111-------------------------------1-------------------11-----111231123231111112-111111--1-1----111-1-111-1111111111111111-111111111111111111111111--111111111111111111111111111111111111111--1111-111111-1212---------------11111-111111111111111111111112111-22-11111-33333322111111111111------1---------------------------1---------------1-1--------1- ------2-421----44431112-211------111----------22333333333--222-11-11----1--111112--------111411----3224111--926B766932-21121332214D21223212-21232222222212283461---24413341--847444O4234555774655633434 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHLYWHQRDLRVPDNRGLHAATDGDTVVPVYVFDDTVLSQVGRPKRAFLAAGVRALRAAY:Sequence : EEEEcccccccTTcHHHHHHccTcEEEEEEEEcHHHHTTccHHHHHHHHHHHHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->148|1u3cA2|3e-18|21.9|146/185|c.28.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->129|PF00875|7e-16|43.3|127/168|DNA_photolyase 61: . . . * . .: 120 :RERGSDLLVREGDAESVLPALADEFDADTVFHAAHYDAARRNRRTRVADALAAAGVDTAG:Sequence :HHTTccEEEEEccHHHHHHHHHHHHTccEEEEEccccHHHHHHHHHHHHHHHcTTcEEEE:Sec Str : XXXXXXXXXXXXXXXXX:SEG|104->120|rtrvadalaaagvdtag :============================================================:RP:SCP|3->148|1u3cA2|3e-18|21.9|146/185|c.28.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->129|PF00875|7e-16|43.3|127/168|DNA_photolyase 121: . . + . . .: 180 :HVDHTLVDPATLDDAYPSHSQFYDDWQQAPKPDPVPAPDADALADVHDDHTLSVPAPEPP:Sequence :EcccccccTTccccccccHHHHHHHHHHHHHTccccccccccccTTccccccccccccTT:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|149->170|apkpdpvpapdadaladvhddh :============================ :RP:SCP|3->148|1u3cA2|3e-18|21.9|146/185|c.28.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$$$$$$$$ :RP:PFM|3->129|PF00875|7e-16|43.3|127/168|DNA_photolyase 181: . * . . . .: 240 :LPDAGHAAATDRLAAFLDDGIASYNDTRDDLAAAVDAPASAVSRLSPYLAAGNIGVREVW:Sequence :TccccHHHHHHHHHHHHHTHHHHHHHHTTcccccTcTTcccccccHHHHHHTcccHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|209->223|ddlaaavdapasavs : ############ :PROS|194->205|PS00136|SUBTILASE_ASP|PDOC00125| : ==========================================================:RP:SCP|183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7 241: + . . . . *: 300 :AAVADAYDDATGNAARNIGKYRYELSWREQNYHLLYHTPRLQTENYVSFDAPIAWQNSDD:Sequence :HHHHHHcGGGGGTcTTHcHHHHHHHHHHHHHHHHHHHcGGGGGTccccGGGGccccccHH:Sec Str :XXXXXXXXXX :SEG|241->250|aavadaydda :============================================================:RP:SCP|183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7 301: . . . . + .: 360 :HFEAWTRGETGYPLVDAGMRQLRAEGYVHNRPRQVVASFLTKHLLVDWRRGERHFADRLV:Sequence :HHHHHHHTccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHTccccHHHHHHHHHTTcT:Sec Str : ############# :PROS|310->322|PS00394|DNA_PHOTOLYASES_1_1|PDOC00331| :============================================================:RP:SCP|183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7 361: . . . * . .: 420 :DYDPANNAANWQWTASTGTDTVAVRIFDPVSQMAKYDSDAAFVTEYVPELRGVDPETIVD:Sequence :TccHHHHHHHHHHHTTccTTccTTccccHHHHHHHHTTTcHHHHHHcGGGTTccTTGGGc:Sec Str :============================================================:RP:SCP|183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1 :============================================================:BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7 421: . . + . . .: 480 :WPTLRHSQRERLAPDYHHPIVDRDHAYERAQRVFEAALDGDA :Sequence :HHHHHHTTTTTcccccccccccHHHHHHHHHHHHHHHH :Sec Str :================================== :RP:SCP|183->454|1u3cA1|3e-73|29.3|266/300|a.99.1.1 :===================================== :BL:SWS|1->457|PHR_HALSA|2e-83|44.8|451/481 :$$ :RP:PFM|185->422|PF03441|6e-44|46.1|230/252|FAD_binding_7