[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM55757.1"

            "translation elongation factor aEF-2"
            ""

OrgPattern 11111111111111111111111111111222222111111111111111111322211111111111 4443644444344434433-3433423333323555545534444533444345533433445343565443555454444432333365552555323545444634453333333333333345656665554544444444437665665345554445566555566554555555545555223334334444444434444445333334443335444444444564444444444444434444445545544444664455564444434544444444444456545545434444444643446544474544556666666666566577666665644556536664345434444334443543365444454565443444444444444444416646656455435554454555444444644444544443333333333335465333333333322434444444444433333544455554544454444344445644444444566653555555444555555445454444444444444455546668646556665456656666677776666433333343333333333333333344443534545556555555655556455565223533343344444434544444444444-44444444444444444445553444434444444444444444444444442433333333333223344444444454645434433443433333444444444445555554444555544444444444444555555555565765544444444444444535544444444423343522224-23422323332432323333333334333353 99239972R9927786677666766666666766666897777666577766776676677677666626666767737866666678-AB76789666667677C29FGC9C66B96665565DB6B4Hx919AD5635A568466564656F4A5697Ga57775858RF7B787B8*A9899JCRJ6CDB9EA799 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGRRKKIVQECERLMDEPDNIRNIAIAAHVDHGKTTLSDNLLAGAGMISQDTAGEQLAMD:Sequence :cccTEEcHHHHHHHTTcGGGEEEEEEEEcTTccHHHHHHHHHHHHHHcEEEccccccccc:Sec Str : #:PROS|60->75|PS00301|EFACTOR_GTP|PDOC00273| : =====================================================:RP:SCP|8->273|1n0uA2|9e-49|34.2|257/323|c.37.1.8 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->172|PF00009|3e-21|39.9|148/183|GTP_EFTU 61: . . . * . .: 120 :TKEDEQERGITIDAANVSMTHEYEDTNHLINLIDTPGHVDFGGDVTRAMRAVDGALVVVD:Sequence :cccEEEEEEEccTTTTTcccccccccEEEEEEEcccccccTTTHHHHHHTTccEEEEEEE:Sec Str : XXXXXXXXXX:SEG|111->125|avdgalvvvdavega :############### :PROS|60->75|PS00301|EFACTOR_GTP|PDOC00273| :============================================================:RP:SCP|8->273|1n0uA2|9e-49|34.2|257/323|c.37.1.8 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|21->172|PF00009|3e-21|39.9|148/183|GTP_EFTU 121: . . + . . .: 180 :AVEGAMPQTETVLRQALREGVKPALFINKVDRLISELQEGPQEMQERLMSVIADVNELIR:Sequence :TTTcccHHHHHHHHHHHHTTcEEEEEEEcHHHHHTTcccccHHHHHHccEEEcEEEEEET:Sec Str :XXXXX :SEG|111->125|avdgalvvvdavega :============================================================:RP:SCP|8->273|1n0uA2|9e-49|34.2|257/323|c.37.1.8 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|21->172|PF00009|3e-21|39.9|148/183|GTP_EFTU 181: . * . . . .: 240 :GMAENMDDIPEDWTVSVEDGTVGFGSALYKWGVSMPSMQRTGMDFGDIMDLEQNDKRDEL:Sequence :TEEEEEEETTTTEEEEEETTEEEEEcccGGGHHHHHHHHHHHccGGGGGccHHHHHHHHH:Sec Str :============================================================:RP:SCP|8->273|1n0uA2|9e-49|34.2|257/323|c.37.1.8 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 241: + . . . . *: 300 :HERTPLSDVVLDMVCEHFPNPVDAQPRRVPRIWRGDAESELADTMRMVNEDGEVVFMVTD:Sequence :HHHccHHHHHHHHHHHHcccHHHHHHHcHHHHccccTTcHHHHHHHTTcTTccEEEEEEE:Sec Str :================================= :RP:SCP|8->273|1n0uA2|9e-49|34.2|257/323|c.37.1.8 : ===========:RP:SCP|290->377|1g7rA1|9e-11|20.5|88/93|b.43.3.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 301: . . . . + .: 360 :ISMDPHAGEIATGRVFSGTLEKGQELYVSGTAGKNRIQSVGLFMGSEREEVDRVPAGNIA:Sequence :EccccTTccEEEEEEEEcEEETTcccEEEcccccccccEEEEEETTEEEEEcEEETTEEE:Sec Str :============================================================:RP:SCP|290->377|1g7rA1|9e-11|20.5|88/93|b.43.3.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|308->374|PF03144|1e-06|35.8|67/69|GTP_EFTU_D2 361: . . . * . .: 420 :SVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAQNMDDLPKLIETLQQVAKEDP:Sequence :EEccTTTccccEEEEccTccccccccccccccEEEEEEEccGGGHHHHHHHHHHHHHHcT:Sec Str :================= :RP:SCP|290->377|1g7rA1|9e-11|20.5|88/93|b.43.3.1 : =================================:RP:SCP|388->465|1fnmA4|3e-19|38.5|78/79|d.58.11.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 :$$$$$$$$$$$$$$ :RP:PFM|308->374|PF03144|1e-06|35.8|67/69|GTP_EFTU_D2 421: . . + . . .: 480 :TIQIEINEDTGEHLISGQGELHLEVITQRIRDNQGIPVITGEPIVVFREQPQEASREVEG:Sequence :TEEEEEEcTTccEEEEEccHHHHHHHHHHHHHTTcccEEEEccccccEEEcccccccEEE:Sec Str :============================================= :RP:SCP|388->465|1fnmA4|3e-19|38.5|78/79|d.58.11.1 : ================:RP:SCP|465->622|1n0uA3|5e-42|31.0|158/165|d.14.1.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 481: . * . . . .: 540 :QSPNRHNKFYLTVEPMAQEIVDAIQLGEVSMDMPELERREALQEAGMDKDTSQNVEDIHR:Sequence :EcTTcccEEEEEEEEccHHHHHHHHTTcccTTccHHHHHHHHHHTcccHHHHTTEETTTc:Sec Str :============================================================:RP:SCP|465->622|1n0uA3|5e-42|31.0|158/165|d.14.1.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 541: + . . . . *: 600 :TNILIDDTKGIQHLNETMELVLEGLQEALDDGPLAAEPVQGSLFRLHDAKLHEDTIHRGP:Sequence :cEEEEEcccccTTHHHHHHHHHHHHHHHTTccTTTccEEccEEEEEEEEEccccGGGccH:Sec Str :============================================================:RP:SCP|465->622|1n0uA3|5e-42|31.0|158/165|d.14.1.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|542->616|PF03764|7e-07|35.6|73/118|EFG_IV 601: . . . . + .: 660 :AQVIPAVRNAVHRSLIDGEVRLLEPIQDVRIDVPSEHMGAASGEIQGRRGRVDDMYQEGD:Sequence :HHHHHHHHHHHHHHHHHTcEEEEEEEEEEEEEEcGGGHHHHHHHHHTTTcEEEEEEEcTc:Sec Str :====================== :RP:SCP|465->622|1n0uA3|5e-42|31.0|158/165|d.14.1.1 : =======================================:RP:SCP|622->707|1darA4|2e-21|32.6|86/90|d.58.11.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 :$$$$$$$$$$$$$$$$ :RP:PFM|542->616|PF03764|7e-07|35.6|73/118|EFG_IV : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|621->697|PF00679|2e-12|42.9|77/88|EFG_C 661: . . . * . .: 720 :LMVVEGIAPVEEMIGFSSDIRSATEGRASWNTENAGFRVLVDNLQREKIMEIRERKGMKL:Sequence :cEEEEEEEEGGGcccHHHHHHHHTTccccccccEEEEEEccccTTHHHHHHHHHHHTccc:Sec Str :=============================================== :RP:SCP|622->707|1darA4|2e-21|32.6|86/90|d.58.11.1 :============================================================:BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|621->697|PF00679|2e-12|42.9|77/88|EFG_C 721: . . + . . .: 780 :ELPQSIDYF :Sequence :ccccGGGTc :Sec Str :========= :BL:SWS|1->729|EF2_HALMA|0.0|87.1|728/728