[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM56299.1"

            "protein of unknown function UPF0118"
            ""

OrgPattern ------------------------31122-31--1----1---------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDEKRFVIALFGLAVGALVGFIAYRFVAPLTVAVFLYYSTRRLFHRLERFRLPARVRAMS:Sequence : XXXXXXXXXXXX :SEG|41->52|rrlfhrlerfrl : =====:BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 61: . . . * . .: 120 :ALSLIAVPLIGLLSYTMLLLVIEARRFIEQYPVAETVGAENSWVGDLAELSNPTFDGIMQ:Sequence :============================================================:BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 121: . . + . . .: 180 :AYESGQLDPLINFASEQATLLASTLSGLVLSLLITIVVTYYLLLDGSKFHEWLLTFDDDA:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|138->159|atllastlsglvlsllitivvt :============================================================:BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 181: . * . . . .: 240 :VVREYLEAVDAELEAVLYGNLLNVIAISIIAVVAYTGYNVIAPELVEVPYPALAGALTGV:Sequence : XXXXXXXXXXX :SEG|204->214|viaisiiavva :============================================================:BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 241: + . . . . *: 300 :ASLIPVIGMKIVYLPLAAVTAVPAALGDEISALVYVAGFLVLAAIVVDTIPDIVLRPYFS:Sequence : XXXXXXXXXXXXX :SEG|254->266|lplaavtavpaal :============================================================:BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 301: . . . . + .: 360 :GKTTHVGLLMLAYIFGPVVFGFHGLFLAPIVLVLALTFADTALIRLLGGDPEEVGPEVPR:Sequence :==================================================== :BL:SWS|56->352|Y1211_METTH|1e-11|26.2|267/334 361: . . . * . .: 420 :GQRQLDEF :Sequence