[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACM56299.1 hlac0 ACM56299.1 "protein of unknown function UPF0118"
MDEKRFVIALFGLAVGALVGFIAYRFVAPLTVAVFLYYSTRRLFHRLERFRLPARVRAMS
ALSLIAVPLIGLLSYTMLLLVIEARRFIEQYPVAETVGAENSWVGDLAELSNPTFDGIMQ
AYESGQLDPLINFASEQATLLASTLSGLVLSLLITIVVTYYLLLDGSKFHEWLLTFDDDA
VVREYLEAVDAELEAVLYGNLLNVIAISIIAVVAYTGYNVIAPELVEVPYPALAGALTGV
ASLIPVIGMKIVYLPLAAVTAVPAALGDEISALVYVAGFLVLAAIVVDTIPDIVLRPYFS
GKTTHVGLLMLAYIFGPVVFGFHGLFLAPIVLVLALTFADTALIRLLGGDPEEVGPEVPR
GQRQLDEF
//