[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM56309.1"

            "respiratory-chain NADH dehydrogenase subunit 1"
            ""

OrgPattern 11-11111111111111112222111111211-------------2-111112-32211131111-11 22212---------11111-11--11111111112111111111-1--1-----1-----32111112221-----------23211111111---1--1-11--22211--------------1111111111212222211121111111111111111111111111111111111111111111--1-1-111111111111111------111111----------11----------------------------------------------------------------------------------------------1-----------------------2--1-1111----21-------22-111111111111111112322211111111111-11111111111111112221112211111111222211111111111222-11131111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111121111---1---231222-222122217222212-2111111111111111111111121211111---------------------1----11--311111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111111--1----------------11111111111-1111111111111-1111111111111--------------11111111111111112-111111------------------------------------11-111-11-121 ---------------------------1---11-11-------1---1------231-----1-1----------------------------1---11----1-1------11111-----1-1--1-12--11-----1--11--------1-1------12--12--1-11-1----------1-6--1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MGTAPAQLFPEFLVDTFGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKRKITAAFT:Sequence : ===========:BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 : $$$$$$$$$:RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh 61: . . . * . .: 120 :DRIAVNRIGPFGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMG:Sequence :============================================================:BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh 121: . . + . . .: 180 :QIGPLNIHLADPEVGLALVFAFASIASVSLVMAGYASNNKYSLLGGLRAVAQNLAYEIPL:Sequence : ======:RP:SCP|175->270|1bf2A2|3e-07|11.8|85/113|b.71.1.1 :============================================================:BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh 181: . * . . . .: 240 :IVTAMSVVVFAGTLQISGVVGAQTETLVTIAGFDIPAWFAFVNPFAFVLFLTANMAEIGR:Sequence :============================================================:RP:SCP|175->270|1bf2A2|3e-07|11.8|85/113|b.71.1.1 :============================================================:BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh 241: + . . . . *: 300 :NPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGGAILSVVFLGGASGPGPESIS:Sequence :============================== :RP:SCP|175->270|1bf2A2|3e-07|11.8|85/113|b.71.1.1 :============================================================:BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh 301: . . . . + .: 360 :FIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTAVIVGVIA :Sequence :================================================== :BL:SWS|50->350|NUOH_DEHSC|6e-63|43.5|283/353 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|52->349|PF00146|3e-52|44.9|283/306|NADHdh