[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACM56309.1 hlac0 ACM56309.1 "respiratory-chain NADH dehydrogenase subunit 1"
MGTAPAQLFPEFLVDTFGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKRKITAAFT
DRIAVNRIGPFGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLGFSVIPMG
QIGPLNIHLADPEVGLALVFAFASIASVSLVMAGYASNNKYSLLGGLRAVAQNLAYEIPL
IVTAMSVVVFAGTLQISGVVGAQTETLVTIAGFDIPAWFAFVNPFAFVLFLTANMAEIGR
NPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGGAILSVVFLGGASGPGPESIS
FIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTAVIVGVIA
//