[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM56606.1"

            "translation initiation factor 2, alpha subunit"
            ""

OrgPattern 11111111111111111111111111111111111111111111111111111111111111111111 11---------------------------------------------------------------------1111111-------------------------------------------------------------11---1---------------------------------------11-----11222222222222222211222222221211211111111--11111111111111-11111-1-----2-1--------1---111-----------------------------------11---111-1--1311111113122-221111-22-1----------1----221-1----1------------------1-----------------------------------------1--------------------------------------------------------------------------------------------111---------------------------------------1-1----1---11---------1---1----1-------------------------------1---111------------------------1--------------------------------------------------------------------------------------------1------------111-------------------------1-11111111-11111-11111111111----1------------111111111111------1111-------------------------------------------111--1 ---------------11-------1---------------------------------11-----------2---------11----1----1----------1----------------------------------------------------------------------------1----1--2---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKYSGWPEPGELVVGDVDEIADFGVFVDLDEYEDKRGLCHISEVASGWIKNVRDHVREGQ:Sequence : EccTTcccEEEEEEEETTEEEEEETTTTTEEEEEcGGGccccccccHHHHTcccc:Sec Str : ======================================================:RP:SCP|7->81|2ahoB2|5e-17|35.7|70/79|b.40.4.5 :============================================================:BL:SWS|1->266|IF2A_HALMA|e-105|69.5|266/266 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->79|PF00575|4e-07|38.2|68/74|S1 61: . . . * . .: 120 :TVVAKVLDVDESANQIDLSIKDVNEHQRKDKIQDWKNSQKADNWMLIALGEDVDDDRYTA:Sequence :EEEcEEEEEETTTTEEEEEcccccTTHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHH:Sec Str :===================== :RP:SCP|7->81|2ahoB2|5e-17|35.7|70/79|b.40.4.5 : ======================================:RP:SCP|83->143|2ahoB1|3e-07|23.0|61/91|a.60.14.1 :============================================================:BL:SWS|1->266|IF2A_HALMA|e-105|69.5|266/266 :$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->79|PF00575|4e-07|38.2|68/74|S1 121: . . + . . .: 180 :VANALLVEFDSLYDAFEAAAISGEEALEEIDIDDDALDAIVTAARDNVSVPYVDVTGYVD:Sequence :HTTHHTTTTccHHHHHHHHHHccTHHHHTTTccTTTHHHHHHHHHHHHHHTcEEEEEEEE:Sec Str : XXXXXXXXXXXXXXXXX :SEG|144->160|eealeeididddaldai :======================= :RP:SCP|83->143|2ahoB1|3e-07|23.0|61/91|a.60.14.1 : ========:RP:SCP|173->237|2ahoB3|2e-14|24.6|65/89|d.58.51.1 :============================================================:BL:SWS|1->266|IF2A_HALMA|e-105|69.5|266/266 181: . * . . . .: 240 :LESTAPNGVDDVKAALEAAEGNGEVPDGVDLEVGYVGSPEYRIKVRAPNYKTAEDQLEAA:Sequence :EEcccTTHHHHHHHHHHHHcccTTccccccEEEEEccccEEEEEEEEccGGGHHHHHHHH:Sec Str : XXX:SEG|238->251|eaaaarareaieaa :========================================================= :RP:SCP|173->237|2ahoB3|2e-14|24.6|65/89|d.58.51.1 :============================================================:BL:SWS|1->266|IF2A_HALMA|e-105|69.5|266/266 241: + . . . . *: 300 :AARAREAIEAAGGSGGFHRDRHEDDE :Sequence :HHHHHHHHTTTTcEEEEcc :Sec Str :XXXXXXXXXXX :SEG|238->251|eaaaarareaieaa :========================== :BL:SWS|1->266|IF2A_HALMA|e-105|69.5|266/266