[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM56614.1"

            "O-methyltransferase family 3"
            ""

OrgPattern ------------------------1111-111------------------1---------------11 -12-----------12211-1----1111111-11122---2-2-1-1---------1--211-1111111--------------11-111111--1--11111111111--------------------------11122-----21----1-----------1-21121---------------------111111111211111112111211111---21111111-21---------------1---1-----------------------------1-----------------11--1111-1111---11------1111111111111111111111-11-1-11--1111--11--1111------1--------11111---12--1-----------------1---2--1---11-221---1--1----------11111111---1--1111---------------------------------------111-1-----11--------111---------------------1-----1--------111-------------------2--1-1------12-1------------------------------------------------------------1-----------------------------------------------------------------------------------------------1-----1111--1-1---------------111111----1-2222-------------------------------------------------------11----------------------------------------------------- ------------------------------------------------11---------------------------------------1-1-111-----------------121---------------------------------------------------------1---1-71-1-11--1-11------1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDILSDSAERFLAATAPEHTATQVEMAALADDWGFPISGPEAGAVLRLLARLTDAERVFE:Sequence :cccccHHHHHHHHHTcccccHHHHHHHTTTcTTGGGcccHHHHHHHHHHHHHHTccEEEE:Sec Str : ======================:RP:SCP|39->169|1h1dA|3e-24|28.2|131/214|c.66.1.1 : ===================================:BL:SWS|26->219|YRRM_BACSU|1e-13|28.9|187/217 : $$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->214|PF01596|1e-19|37.3|161/191|Methyltransf_3 61: . . . * . .: 120 :FGSGFGYSATWFLRGGADAVICAEFDEEEAKRGVQFAADGGYADSVTFEVGDAMETIERY:Sequence :EccTTcHHHHHHHTcTTcEEEEEEccHHHHHHHHHHHHHHTcGGGEEEEEccHHHHHHHH:Sec Str :============================================================:RP:SCP|39->169|1h1dA|3e-24|28.2|131/214|c.66.1.1 :============================================================:BL:SWS|26->219|YRRM_BACSU|1e-13|28.9|187/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->214|PF01596|1e-19|37.3|161/191|Methyltransf_3 121: . . + . . .: 180 :DGPFDVVLIDHLKGRYADAYRAVLPKVRTGGVIVADNITRGPIDFGDLVAHFEDGAPLPD:Sequence :HTcEEEEEEcccGGGHHHHHHHHHHTEEEEEEEEEEcTTGGGGTTTTTHHHHHGGGGGcc:Sec Str :================================================= :RP:SCP|39->169|1h1dA|3e-24|28.2|131/214|c.66.1.1 :============================================================:BL:SWS|26->219|YRRM_BACSU|1e-13|28.9|187/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|40->214|PF01596|1e-19|37.3|161/191|Methyltransf_3 181: . * . . . .: 240 :PEVDGETRGIGEYVGTVRSDEAVETAILPVGSGIAVSTKVE :Sequence :ccccHHHHHHHHHHHHHTTcTTEEEEEEcccTcEEEEEEcc :Sec Str :======================================= :BL:SWS|26->219|YRRM_BACSU|1e-13|28.9|187/217 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|40->214|PF01596|1e-19|37.3|161/191|Methyltransf_3