[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM57204.1"

            "oxidoreductase domain protein"
            ""

OrgPattern --------1111111-12------5--2-33-----------------------------11------ 125-4---111----2-----1---1------1-1--24641--139--112557--2-----32134431-----------4-----1111-1-------1-1222712---------------11111-1111122299---1--11-11---1111-11-11--1-1111-111111111221---113--22222--3-2-2---64111312--43-5-11111112D2-1-1--2--11-------------1------1--11-----------------------------------------------------11-12---------------11--3---1-1------1-----53332----33222-----3--2---------33442334443-2212212137--666378B77864--111354212242---------211--2---------------------------------12-1-----111113-----1112------111--------13----1--112---1--------------------------------1111------11-11---------------------------------1-1--2-----------------1--1-------------2--31211111111111-111111111-11-11111-4442221-12--11111-1111--5------1--111111111111---------------315---111-----122-----------32-----212------2-1-------------1-------1--11--------------1---1111----------1-------------1------------12---211--1- -------------2-----------------------------------1-1-1----------------------------------------21-------1-1----2------------------------------------------1---------1--1--1-----3------------1-----2111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTQQPLRIGVLGYRFMGKAHANALARLPMFFPDAPDIERHTLVGRDEEALADAAERFGFS:Sequence :cccccEEEEEEcccTTcccTTTTHHHHHHHTTTTEEEEEEEcccHHHHHHHHHHTTcTTc:Sec Str : XXXXXXXXXX :SEG|46->55|deealadaae : =========================================================:RP:SCP|4->153|1zh8A1|3e-21|19.4|144/181|c.2.1.3 :============================================================:BL:SWS|1->280|YRBE_BACSU|6e-17|29.3|246/341 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->109|PF01408|3e-13|43.2|95/119|GFO_IDH_MocA 61: . . . * . .: 120 :HTATDWEDSLDEVDVFYNLGPNHVHAEPSIAALEAGVPVLCEKPLAPTLDEAAAMRDAAA:Sequence :EEEccHHHHHHcccccEEEccHHHHHHHHHHHHHHGGEEEEEccccccHHHHHHHHHHHH:Sec Str : XXXXXXXXXXX:SEG|110->129|deaaamrdaaadadvpagta :============================================================:RP:SCP|4->153|1zh8A1|3e-21|19.4|144/181|c.2.1.3 :============================================================:BL:SWS|1->280|YRBE_BACSU|6e-17|29.3|246/341 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->109|PF01408|3e-13|43.2|95/119|GFO_IDH_MocA 121: . . + . . .: 180 :DADVPAGTAFNYRFIPAIRYAKGLIEDGELGEIRQVRGRYLQDWLVDPEAPWAWRMDADT:Sequence :TTTcEEEEEcGGGGcHHHHHHHHHHHTTTTccEEEEEEEEEccccEEETTccGGGGcTTc:Sec Str :XXXXXXXXX :SEG|110->129|deaaamrdaaadadvpagta :================================= :RP:SCP|4->153|1zh8A1|3e-21|19.4|144/181|c.2.1.3 : =============================================:RP:SCP|136->283|2nvwA2|6e-24|21.7|143/178|d.81.1.5 :============================================================:BL:SWS|1->280|YRBE_BACSU|6e-17|29.3|246/341 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|142->260|PF02894|4e-15|52.5|99/107|GFO_IDH_MocA_C 181: . * . . . .: 240 :AGSGALGDLGAHTLDLADFLVGDEVGEIDRVSGHLQTFVDERPVYDEAGDVEEYRDVTVD:Sequence :ccccTTTTHHHHHHHHHHHHHTccEEEEEEEEEEEEccccEEEEEcTTccEEEEEEcccc:Sec Str :============================================================:RP:SCP|136->283|2nvwA2|6e-24|21.7|143/178|d.81.1.5 :============================================================:BL:SWS|1->280|YRBE_BACSU|6e-17|29.3|246/341 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|142->260|PF02894|4e-15|52.5|99/107|GFO_IDH_MocA_C 241: + . . . . *: 300 :DAYTAQVAYESGAMGSFEATRFAEGHKNDHAIEIHGSKGSLKFSLERLNELEVLREDDRG:Sequence :cEEEEEEEETTTTEEEEEEEEccccccccEEEEEEEcccEEEEEccccEEEEEEEcccEE:Sec Str : XXXXXXXXXXXXXXX :SEG|285->299|lerlnelevlreddr :=========================================== :RP:SCP|136->283|2nvwA2|6e-24|21.7|143/178|d.81.1.5 :======================================== :BL:SWS|1->280|YRBE_BACSU|6e-17|29.3|246/341 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|142->260|PF02894|4e-15|52.5|99/107|GFO_IDH_MocA_C 301: . . . . + .: 360 :YQTVLVTDETDPYVDHWWPPGHVIGWEHTFVHENYEFLSAVAEGGEFEPSFEQGYKVQKL:Sequence :EEEEccccHHHHHHHHHHHHHHHHHTTTTccTTccccccccTTcccccccHHHHHHHHHH:Sec Str 361: . . . * . .: 420 :LDAVERADERGEWVSVE :Sequence :HHHHHHHHHHTccEEcT :Sec Str