[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM57207.1"

            "Mandelate racemase/muconate lactonizing protein"
            ""

OrgPattern 11--11-12232122-2-------51123122---------------------1-------2122--- 13312-11111-1--11----1---2-------1111334-----21----1213--1----2-2-612-3-----------2-----222--1-----1-1-21131-2-----------------1-----1-122222---31-21-1111111--1111---1111-------------3231111-112333332332333333-1332333321232112111124-1-------------------2--121111------21-----111----------------------------------------------111------------1----------------1------1---1-1-1-2-32112-----114331121112122222222223-11211411751-343-212463432412--212111225---------11---11-------------------------------1421----74333342111144431112-14251851--11---111314141--1----------------2-1--1--1-1--1----1-11------1--31----------------------1---1----1--1--3-----------------1--1-------------1143-211111111111-111111111111111111323244---332232222212222221111111--122222222222---------11111--11---1-----------1111111-1---22221221-11111---1----11------1-----111--1111111111--------------------------------------------------1211112111-1- ----11--------------11112----1--1--11------------1--42-------------------------------------------------------1-----------------------------------------------------1---------------------2114-12--1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTV:Sequence :ccEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEETTccEEEEEEcccHHHcccHHHH:Sec Str : =======================================================:RP:SCP|6->122|2gdqA2|2e-18|23.1|108/115|d.54.1.1 : ================================================:BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->122|PF02746|2e-08|42.3|97/110|MR_MLE_N 61: . . . * . .: 120 :EAVLPDLLDAVERVGDPHALHEIEAELAAVVNGNPAARAAVSIAVHDLAAKRLGVPLHRL:Sequence :HHTHHHHHHHHTTTTccGGGHHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHHHTccHHHH:Sec Str : XXXXXXXXXXXX :SEG|78->89|halheieaelaa :============================================================:RP:SCP|6->122|2gdqA2|2e-18|23.1|108/115|d.54.1.1 :============================================================:BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->122|PF02746|2e-08|42.3|97/110|MR_MLE_N 121: . . + . . .: 180 :WGLDPTAAPATSYTIGLDETERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPD:Sequence :TTccccEEEEccEEEccccHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHHTcTT:Sec Str :== :RP:SCP|6->122|2gdqA2|2e-18|23.1|108/115|d.54.1.1 : ==================================================:RP:SCP|131->291|1r0mA1|1e-38|31.9|160/243|c.1.11.2 :============================================================:BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321 :$$ :RP:PFM|22->122|PF02746|2e-08|42.3|97/110|MR_MLE_N : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|143->233|PF01188|1e-10|44.0|91/98|MR_MLE 181: . * . . . .: 240 :ARLRVDANEAWTPREAVRKCEWLADRDVEFVEQPVPAEDPEGLRFVYERSALPVAADESC:Sequence :cEEEEEcTTcccHHHHHHHHHHHHHTcEEEEEccccTTcHHHHHHHHHHccccEEEcTTc:Sec Str : ################################ :PROS|183->214|PS00909|MR_MLE_2|PDOC00706| :============================================================:RP:SCP|131->291|1r0mA1|1e-38|31.9|160/243|c.1.11.2 :============================================================:BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|143->233|PF01188|1e-10|44.0|91/98|MR_MLE 241: + . . . . *: 300 :VTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHGLEVMCGCMIESNASIAAAAQ:Sequence :ccHHHHHHHHHHccEEEEcHHHHHHHHHHHHHHHHHHTcccEEEEccccccHHHHHHHHH:Sec Str : XXXXXXXX:SEG|293->311|asiaaaaqlaplldyadld :=================================================== :RP:SCP|131->291|1r0mA1|1e-38|31.9|160/243|c.1.11.2 :============================================================:BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321 301: . . . . + .: 360 :LAPLLDYADLDGSLLLAEDQYDGIEMGGGEIRLGDQERAGTGARPSAEQ :Sequence :HHTcccEEEcccTTTTcccccTTccccTTEEEccccccTcGGTTc :Sec Str :XXXXXXXXXXX :SEG|293->311|asiaaaaqlaplldyadld :================================= :BL:SWS|13->333|YCJG_ECOLI|6e-33|31.1|309/321