[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACM57207.1 hlac0 ACM57207.1 "Mandelate racemase/muconate lactonizing protein"
MTLETEFERVSLPLENPFTIFRGTQTDAENVIVKIADEAGMTGVGGAAPSAHYGETADTV
EAVLPDLLDAVERVGDPHALHEIEAELAAVVNGNPAARAAVSIAVHDLAAKRLGVPLHRL
WGLDPTAAPATSYTIGLDETERVREKAEAAVDAGYPILKIKLGTDRDRELIDAVREAAPD
ARLRVDANEAWTPREAVRKCEWLADRDVEFVEQPVPAEDPEGLRFVYERSALPVAADESC
VTLSDIPAIADRCDIANLKLMKTGGLLEAKRMIAAARAHGLEVMCGCMIESNASIAAAAQ
LAPLLDYADLDGSLLLAEDQYDGIEMGGGEIRLGDQERAGTGARPSAEQ
//