[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM57501.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------------------------3---111------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATTTEPADGSPDLLDDAREALRTEHRRVGDEYGAFRAFLGRVASVPSEPIRTDGGAGPI:Sequence : XXXXXX:SEG|55->95|ggagpiagsggsigvargasavgtagsssagppagsglvav : #:PROS|60->71|PS00455|AMP_BINDING|PDOC00427| 61: . . . * . .: 120 :AGSGGSIGVARGASAVGTAGSSSAGPPAGSGLVAVRDAYQETVMSVPHYEIEYDDTYQRS:Sequence :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|55->95|ggagpiagsggsigvargasavgtagsssagppagsglvav :########### :PROS|60->71|PS00455|AMP_BINDING|PDOC00427| 121: . . + . . .: 180 :VAEECGPELAYALTRGSRFHAECKRSLIDRVETAIEERERFVETIRSETESVERAASRLA:Sequence : =================================:BL:SWS|148->250|K2C71_PONAB|6e-04|29.5|95/523 181: . * . . . .: 240 :PIQSEVASTARTDFTEDGFGTLDAYRARAEALIGDCDRIATRRQRELACYERDLAIDGDL:Sequence :============================================================:BL:SWS|148->250|K2C71_PONAB|6e-04|29.5|95/523 241: + . . . . *: 300 :DVPTYLYQDLDATYPVLATVGTVGDRLDDLKRRIERAMAHAS :Sequence :========== :BL:SWS|148->250|K2C71_PONAB|6e-04|29.5|95/523