[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACM57501.1 hlac0 ACM57501.1 "conserved hypothetical protein"
MATTTEPADGSPDLLDDAREALRTEHRRVGDEYGAFRAFLGRVASVPSEPIRTDGGAGPI
AGSGGSIGVARGASAVGTAGSSSAGPPAGSGLVAVRDAYQETVMSVPHYEIEYDDTYQRS
VAEECGPELAYALTRGSRFHAECKRSLIDRVETAIEERERFVETIRSETESVERAASRLA
PIQSEVASTARTDFTEDGFGTLDAYRARAEALIGDCDRIATRRQRELACYERDLAIDGDL
DVPTYLYQDLDATYPVLATVGTVGDRLDDLKRRIERAMAHAS
//