[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "hlac0:ACM57526.1"

            "protein of unknown function DUF1684"
            ""

OrgPattern ------------------------11112121------------------------------------ -11-2-------------------------------1111-1--12---232222---------1----1-------------------------------1111-131------------------------------------1-------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------11-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11222222221111---------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTETTPDDDWAAQIEAQRRAKHEHFRDSARSPLPASMRGDAFPGLAYFDPDPAYRFVVPL:Sequence : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->181|PF07920|7e-28|52.9|140/143|DUF1684 61: . . . * . .: 120 :HEHDEKETVTVETTADGEQTYRRWGEFRLEIDGETVTLQAYRPTDGADRFWVPFRDETSG:Sequence : =========================================================:BL:SWS|64->157|EFG_BIFAA|3e-04|30.4|92/709 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->181|PF07920|7e-28|52.9|140/143|DUF1684 121: . . + . . .: 180 :ETTYGAGRYLDLEPDRDRVDGEWVVDCNVAYNPTCAYNHAYECPLIPMENWLDVAIEAGE:Sequence :===================================== :BL:SWS|64->157|EFG_BIFAA|3e-04|30.4|92/709 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->181|PF07920|7e-28|52.9|140/143|DUF1684 181: . * . . . .: 240 :KKFPAEPAGADH :Sequence :$ :RP:PFM|41->181|PF07920|7e-28|52.9|140/143|DUF1684