[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACM57526.1 hlac0 ACM57526.1 "protein of unknown function DUF1684"
MTETTPDDDWAAQIEAQRRAKHEHFRDSARSPLPASMRGDAFPGLAYFDPDPAYRFVVPL
HEHDEKETVTVETTADGEQTYRRWGEFRLEIDGETVTLQAYRPTDGADRFWVPFRDETSG
ETTYGAGRYLDLEPDRDRVDGEWVVDCNVAYNPTCAYNHAYECPLIPMENWLDVAIEAGE
KKFPAEPAGADH
//