[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "huge0:KIAA0059"

            ""
ABLM1_HUMAN  "RecName: Full=Actin-binding LIM protein 1;AltName: Full=Actin-binding LIM protein family member 1;         Short=abLIM-1;AltName: Full=Actin-binding double zinc finger protein;AltName: Full=LIMAB1;AltName: Full=Limatin;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----883-----35433223223221243244434322131233232121122121322111311-12-11-1-11----11111132-11232111212-22584-F3-U*****pRPPMUlS**L*O***4*v*MRWRzSYobBfUSNnMF*RfcYaFRUZJHJC*LJ*CPKB1---7-----41132-1---2111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :NPGALCMLMTLEMTELTDPHHTMGDYKVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQ:Sequence : ccccccccccccccccccccccccccccccccEEEET:Sec Str : XXXXXXXXXXX :SEG|7->17|mlmtlemtelt : ################:PROS|45->78|PS00478|LIM_DOMAIN_1|PDOC00382| : ===============================:RP:SCP|30->92|1oqjA|7e-07|10.0|61/90|d.217.1.1 : =================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 : $$$$$$$$$$$$$$$$:RP:PFM|45->92|PF00412|6e-08|44.9|48/57|LIM 61: . . . * . .: 120 :TKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALG:Sequence :TEEEETTTcccccccccTTccccEEETTEEEcHHHHTTccccccccccccccccEEEccc:Sec Str :################## :PROS|45->78|PS00478|LIM_DOMAIN_1|PDOC00382| : #################:PROS|104->137|PS00478|LIM_DOMAIN_1|PDOC00382| :================================ :RP:SCP|30->92|1oqjA|7e-07|10.0|61/90|d.217.1.1 : ======================================== :RP:SCP|71->110|2d8yA2|2e-09|17.5|40/42|g.39.1.3 : ===================================:RP:SCP|86->128|1x64A1|6e-12|27.9|43/45|g.39.1.3 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|45->92|PF00412|6e-08|44.9|48/57|LIM : $$$$$$$$$$$$$$$$$:RP:PFM|104->155|PF00412|3e-08|45.3|51/57|LIM 121: . . + . . .: 180 :KTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIK:Sequence :cEEETTTcccTTcTGGGGGGcccHHHHHTTcTTccccccccccccccTTcccccccccTT:Sec Str :################# :PROS|104->137|PS00478|LIM_DOMAIN_1|PDOC00382| : #########:PROS|172->206|PS00478|LIM_DOMAIN_1|PDOC00382| :======== :RP:SCP|86->128|1x64A1|6e-12|27.9|43/45|g.39.1.3 : =================================== :RP:SCP|128->162|1v6gA2|6e-04|62.9|35/40|g.39.1.3 : ==========================================:RP:SCP|139->234|2fiyA1|3e-08|23.1|78/285|e.59.1.1 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|104->155|PF00412|3e-08|45.3|51/57|LIM : $$$$$$$$$:RP:PFM|172->223|PF00412|3e-11|48.1|52/57|LIM 181: . * . . . .: 240 :NGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITG:Sequence :cccTTcHHHHHHcccTTcHHHHHHHHTHHTTcccccccHHHHHHHHTTcccccccccccc:Sec Str :########################## :PROS|172->206|PS00478|LIM_DOMAIN_1|PDOC00382| : ##########:PROS|231->264|PS00478|LIM_DOMAIN_1|PDOC00382| :====================================================== :RP:SCP|139->234|2fiyA1|3e-08|23.1|78/285|e.59.1.1 : ==============================:RP:SCP|211->254|1x64A1|2e-13|25.0|44/45|g.39.1.3 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|172->223|PF00412|3e-11|48.1|52/57|LIM 241: + . . . . *: 300 :KVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRPTRTSSE:Sequence :cEEEccccEEETTTcccTTcTGGGGGGcccHHHHHTTcTTccccHHHccc :Sec Str :######################## :PROS|231->264|PS00478|LIM_DOMAIN_1|PDOC00382| :============== :RP:SCP|211->254|1x64A1|2e-13|25.0|44/45|g.39.1.3 : ======================================= :RP:SCP|257->295|1wigA2|2e-17|59.0|39/41|g.39.1.3 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 301: . . . . + .: 360 :SIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGY:Sequence : :Sec Str : XXXXXXXXXX :SEG|306->315|pgssipgspg :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 361: . . . * . .: 420 :DDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSP:Sequence : :Sec Str :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 421: . . + . . .: 480 :QHFHRPGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHAAL:Sequence : :Sec Str :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 481: . * . . . .: 540 :AAQSKSSEDIIKFSKFPAAQAPDPSETPEIETDHWPGPPSFAVIGPDMKRRSSGREEDDE:Sequence : :Sec Str : XXXXXX:SEG|535->553|reeddeellrrrqlqeeql :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 541: + . . . . *: 600 :ELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTA:Sequence : :Sec Str :XXXXXXXXXXXXX :SEG|535->553|reeddeellrrrqlqeeql : XXXXXXXXXXXXXXXXXXX :SEG|565->583|lkeemekesrerssllasr :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 601: . . . . + .: 660 :SLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPK:Sequence : ccccccc:Sec Str : ======:RP:SCP|655->724|1ujsA|1e-31|62.9|70/88|a.14.1.1 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 661: . . . * . .: 720 :IFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKK:Sequence :cccTTTTcccTTTTccccccccTTTGGGGccTTHHHHHHcccHHHHTTccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|655->724|1ujsA|1e-31|62.9|70/88|a.14.1.1 :============================================================:BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|689->724|PF02209|2e-08|55.6|36/36|VHP 721: . . + . . .: 780 :AKLF :Sequence :TTcc :Sec Str :==== :RP:SCP|655->724|1ujsA|1e-31|62.9|70/88|a.14.1.1 :==== :BL:SWS|28->724|ABLM1_HUMAN|0.0|99.7|697/778 :$$$$ :RP:PFM|689->724|PF02209|2e-08|55.6|36/36|VHP