[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "huge0:KIAA0101"

            ""
PAF_HUMAN   "RecName: Full=PCNA-associated factor;AltName: Full=p15PAF;AltName: Full=Overexpressed in anaplastic thyroid carcinoma 1;         Short=OEATC-1;AltName: Full=Hepatitis C virus NS5A-transactivated protein 9;         Short=HCV NS5A-transactivated protein 9;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------11111111-1111112-1-13111111--1111-2111-11111----1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :NTLGWEVSSFSPLLSSCLNMVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSR:Sequence : XXXXXXXXXXXXX :SEG|47->59|sstsatnstsvss : =========================================:BL:SWS|20->130|PAF_HUMAN|7e-54|100.0|111/111 61: . . . * . .: 120 :KAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPL:Sequence :============================================================:BL:SWS|20->130|PAF_HUMAN|7e-54|100.0|111/111 121: . . + . . .: 180 :QPDHTNDEKE :Sequence :========== :BL:SWS|20->130|PAF_HUMAN|7e-54|100.0|111/111