[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "huge0:KIAA0113"

            ""
TNIP1_HUMAN  "RecName: Full=TNFAIP3-interacting protein 1;AltName: Full=Nef-associated factor 1;         Short=Naf1;AltName: Full=HIV-1 Nef-interacting protein;AltName: Full=Virion-associated nuclear shuttling protein;         Short=VAN;         Short=hVAN;AltName: Full=Nip40-1;"

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------21111251222222A32517b2132621112222412111312113222112-1---------1------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLR:Sequence : :Sec Str :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 61: . . . * . .: 120 :QKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSG:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|72->86|llpppspslgsfdpl :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 121: . . + . . .: 180 :TSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQL:Sequence : :Sec Str :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 181: . * . . . .: 240 :FTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERL:Sequence : :Sec Str : XXX:SEG|238->251|erlreenlelkkll :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 241: + . . . . *: 300 :REENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAE:Sequence : HH:Sec Str :XXXXXXXXXXX :SEG|238->251|erlreenlelkkll :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|260->430|PF05557|5e-07|22.8|171/668|MAD 301: . . . . + .: 360 :KKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQ:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|260->430|PF05557|5e-07|22.8|171/668|MAD 361: . . . * . .: 420 :RDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHH:Sec Str :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|260->430|PF05557|5e-07|22.8|171/668|MAD 421: . . + . . .: 480 :KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDR:Sequence :HHHHHHHHHH :Sec Str :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 :$$$$$$$$$$ :RP:PFM|260->430|PF05557|5e-07|22.8|171/668|MAD 481: . * . . . .: 540 :ERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPH:Sequence : :Sec Str : XXXXXXXXXXXXXX :SEG|485->498|eekeelkkqveklq :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 541: + . . . . *: 600 :PEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRL:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|547->558|aypyayppmpam : XXXXXXXXXXXXXX :SEG|573->586|ppppmamehppplp :============================================================:BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636 601: . . . . + .: 660 :PCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ :Sequence : :Sec Str :==================================== :BL:SWS|1->636|TNIP1_HUMAN|0.0|100.0|636/636