[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "huge0:KIAA1464"

            ""
RBP10_HUMAN  "RecName: Full=Ran-binding protein 10;         Short=RanBP10;"

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11--3411311-1132242223222232222222222222222222222233232222222221-1211-11-2-1111111111-22-2532324222121187A-19-55464443332333432527O3143A233343333233233334322322332223332221211123-----235-132721-36451 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :KMAAATADPGAGNPQPGDSSGGGAGGGLPSPGEQELSRRLQRLYPAVNQQETPLPRSWSP:Sequence : cccccccccccccccccHHHHcccHHH:Sec Str : XXXXXXXXXXXXXXXXX :SEG|16->32|pgdssgggaggglpspg : ===========:RP:SCP|50->224|2fbeA1|2e-28|13.2|174/188|b.29.1.22 : ===========================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 61: . . . * . .: 120 :KDKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMG:Sequence :HHccccEEEcccccEEEEccTTTcccccccEEEEEEEcT TcEEEEEEEEEccccccccE:Sec Str :============================================================:RP:SCP|50->224|2fbeA1|2e-28|13.2|174/188|b.29.1.22 :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 : $$$$$$$$$$$$$$$$$$$:RP:PFM|102->213|PF00622|1e-20|48.1|108/120|SPRY 121: . . + . . .: 180 :IGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGT:Sequence :EEEEcccTTccccccccccEEEEcccGEEEEcccEEEEcccccGcccccEEEEEcTTTcc:Sec Str :============================================================:RP:SCP|50->224|2fbeA1|2e-28|13.2|174/188|b.29.1.22 :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|102->213|PF00622|1e-20|48.1|108/120|SPRY 181: . * . . . .: 240 :CFYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQG:Sequence :EEEEEcccEEEEEEccccccEEEEEEccTTEEEEEEEEEccc :Sec Str :============================================ :RP:SCP|50->224|2fbeA1|2e-28|13.2|174/188|b.29.1.22 :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|102->213|PF00622|1e-20|48.1|108/120|SPRY 241: + . . . . *: 300 :TVHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQ:Sequence : :Sec Str : ==================================================:RP:SCP|251->330|1uujA|1e-09|22.9|70/76|a.221.1.1 :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 301: . . . . + .: 360 :KLVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQ:Sequence : :Sec Str :============================== :RP:SCP|251->330|1uujA|1e-09|22.9|70/76|a.221.1.1 :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 361: . . . * . .: 420 :DSYPGSPSLSPRHGPSSSHMHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSS:Sequence : :Sec Str : XXXXXXXXXXX:SEG|410->437|sssssssssssssspssvnysesnstds :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 421: . . + . . .: 480 :SSSPSSVNYSESNSTDSTKSQHHSSTSNQETSDSEMEMEAEHYPNGVLGSMSTRIVNGAY:Sequence : :Sec Str :XXXXXXXXXXXXXXXXX :SEG|410->437|sssssssssssssspssvnysesnstds :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 481: . * . . . .: 540 :KHEDLQTDESSMDDRHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEML:Sequence : :Sec Str :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|510->595|PF10607|1e-12|47.5|80/101|RanBPM_CRA 541: + . . . . *: 600 :QDAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECL:Sequence : :Sec Str :============================================================:BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|510->595|PF10607|1e-12|47.5|80/101|RanBPM_CRA 601: . . . . + .: 660 :RLMARAGLGSCSFARVDDYLH :Sequence : :Sec Str :===================== :BL:SWS|2->621|RBP10_HUMAN|0.0|100.0|620/620