[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "huge0:KIAA1520"

            ""
ABCB9_HUMAN  "RecName: Full=ATP-binding cassette sub-family B member 9;AltName: Full=ATP-binding cassette transporter 9;         Short=ABC transporter 9 protein;         Short=hABCB9;AltName: Full=TAP-like protein;         Short=TAPL;Flags: Precursor;"

OrgPattern JIF4JEECGHGFIEJIYCFECEENZBFNUDSGD5BBC8DDFC9PQLSZHMznU5GNGFRDGGD8I177 MQbE*VWZjjkUTNWQTLK-Kc99X*LLLLLPebccn***IpO*kvobrVRNrurLOdBBjqof*gp***XVUTTuZWdO*iXA8B9DRRKG5HDHJ--DDOHGJXJYJM8788887BAA8888GPMITWMJRRVPZihtuFEEtNnejoWWfVdLMQHKKKIVbTe***XFPGHHHHMFKGCaRZKIjcAQWw********t********zzvv***Ykn*yijustqsu**XbbcccaabbbbbbZVZVQV*mZby*cLfYkqnNO**cTMahkekjpptwuoyuutpusqllsrnpoYZZYaZbdbcbXZyqmeednmqgm*t*********c*fn***Udea*jiqvyhjQF**mZTXdcQUjclgLQUPERONNIHIGHIXO***XOj*zu*ovwuzxs*trx*-ce*aX*f***MA**************GHKz*******y*TSTTTTTTlPTGRYRx66646666667A779A69988998996B7FBCJ9Dv**u*******nonoj****ytvvbw***xv*q8FqtlrVdZZ*s****SaaERGKdPFIHGJGIOQNTWVWh*NdOkcMakTSZFYYVQQTZOcNNPPnnQmHFFKBDCCFAB798987888GKADFLJmfqLiMSFSIoNSUUSNRXRQRRLXWXTUS4-EFQJG222222*t**S*styyzuywzrs-wtstxtvttvxzwqrsqqr*****jkdnojnnnppopmmpmnm*njjpppqQ4************34GGCFCCDJJLJHAwg*ZWWaXYHRTPNSMRdKMOMMEOEIRlcopnou***m**tua***DDDCCEECDJZljxiijjhsvursORNLLMLLMOAAAA66KRHH889B67667545*AYBAB9A-86A8BEADFD9BKA9A778SalQLa*deY9XL 8866keM-iJCAWccNRULQUXXlXmTOOGJIIWXUGRRORMLIHHYUUidfmjSRZNPNNOKDD9BA2EC7GDGDF2GHABBAGF79-bnFRWVTIHJMGCNXYP6V*x*elaxpzPLONOYNyzN*J**s1*a*QNPOmLU*eHUMMIdHG*QbZXxY**U*abV*Xg*so*gEMHH*BEBML*qu*M**KK*u**g ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :ARHYHSGSPAPGPGPAWPRPVDDDGLAPVSYNLAFSTRPPPTSRMRLWKAVVVTLAFMSV:Sequence : XXXXXXXXXXXXXXX :SEG|6->20|sgspapgpgpawprp : ================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 61: . . . * . .: 120 :DICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCLLLGATIGVAKNSALGP:Sequence :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 121: . . + . . .: 180 :RRLRASWLVITLVCLFVGIYAMVKLLLFSEVRRPIRDPWFWALFVWTYISLGASFLLWWL:Sequence :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 181: . * . . . .: 240 :LSTVRPGTQALEPGAATEAEGFPGSGRPPPEQASGATLQKLLSYTKPDVAFLVAASFFLI:Sequence : =======================:RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 : $:RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 241: + . . . . *: 300 :VAALGETFLPYYTGRAIDGIVIQKSMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFAR:Sequence :============================================================:RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 301: . . . . + .: 360 :LNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINVFLRNTVKVTG:Sequence :============================================================:RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 361: . . . * . .: 420 :VVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMK:Sequence :============================================================:RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 421: . . + . . .: 480 :TVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVI:Sequence :============================================================:RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 481: . * . . . .: 540 :SGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLA:Sequence :=================================================== :RP:SCP|218->531|2hydA2|8e-62|20.7|314/323|f.37.1.1 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$ :RP:PFM|240->495|PF00664|4e-35|34.9|252/274|ABC_membrane 541: + . . . . *: 600 :PDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFY:Sequence : ======================================================:RP:SCP|547->774|1b0uA|1e-45|23.4|222/258|c.37.1.12 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 : $$$$$$$$$$$:RP:PFM|590->715|PF00005|1e-12|38.3|120/123|ABC_tran 601: . . . . + .: 660 :PLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAA:Sequence :============================================================:RP:SCP|547->774|1b0uA|1e-45|23.4|222/258|c.37.1.12 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|590->715|PF00005|1e-12|38.3|120/123|ABC_tran 661: . . . * . .: 720 :QKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAE:Sequence : ############### :PROS|687->701|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|547->774|1b0uA|1e-45|23.4|222/258|c.37.1.12 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|590->715|PF00005|1e-12|38.3|120/123|ABC_tran 721: . . + . . .: 780 :SEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQLLAQGGLYAK:Sequence :====================================================== :RP:SCP|547->774|1b0uA|1e-45|23.4|222/258|c.37.1.12 :============================================================:BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766 781: . * . . . .: 840 :LVQRQMLGLQPAADFTAGHNEPVANGSHKA :Sequence :============================== :BL:SWS|45->810|ABCB9_HUMAN|0.0|100.0|766/766