[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD98844.1"

            "Glucose uptake protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------211----------------------------------------------------------------------------------------------------------------------1222222232222222--1111222-----11333333--12222222222222222211221111112323322122221111-1111----------------------------------111--------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNIIIALIPAVCWGIFPLIASKTGGGPANQILGTGLGATLVGLIVFAIMHPTITASAFIW:Sequence : XXXXXXXXXXXXXXX :SEG|31->45|ilgtglgatlvgliv :============================================================:BL:SWS|1->267|YSUP_LACHE|7e-40|41.4|261/280 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->267|PF06800|2e-23|32.0|244/267|Sugar_transport 61: . . . * . .: 120 :AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKII:Sequence : XX:SEG|119->138|iiglvalaivvvgviltavt :============================================================:BL:SWS|1->267|YSUP_LACHE|7e-40|41.4|261/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->267|PF06800|2e-23|32.0|244/267|Sugar_transport 121: . . + . . .: 180 :GLVALAIVVVGVILTAVTDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTA:Sequence :XXXXXXXXXXXXXXXXXX :SEG|119->138|iiglvalaivvvgviltavt :============================================================:BL:SWS|1->267|YSUP_LACHE|7e-40|41.4|261/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->267|PF06800|2e-23|32.0|244/267|Sugar_transport 181: . * . . . .: 240 :LYLPEMLGILCGALIFVFATRETSALTARESWAGMIGGAIWGIAAFAYIFSAQENGTSSA:Sequence : XXXXXXXXXXXXXXXXX :SEG|213->229|agmiggaiwgiaafayi :============================================================:BL:SWS|1->267|YSUP_LACHE|7e-40|41.4|261/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->267|PF06800|2e-23|32.0|244/267|Sugar_transport 241: + . . . . *: 300 :FIYTQLSVVISTLGGMLFLHERKTSRELGFTLAGLVLLVVGSVITGFI :Sequence : XXXXXXXXXXXXXXXXXXX :SEG|268->286|lgftlaglvllvvgsvitg :=========================== :BL:SWS|1->267|YSUP_LACHE|7e-40|41.4|261/280 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->267|PF06800|2e-23|32.0|244/267|Sugar_transport