[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD98844.1 lsal0 ABD98844.1 "Glucose uptake protein"
MNIIIALIPAVCWGIFPLIASKTGGGPANQILGTGLGATLVGLIVFAIMHPTITASAFIW
AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKII
GLVALAIVVVGVILTAVTDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTA
LYLPEMLGILCGALIFVFATRETSALTARESWAGMIGGAIWGIAAFAYIFSAQENGTSSA
FIYTQLSVVISTLGGMLFLHERKTSRELGFTLAGLVLLVVGSVITGFI
//