[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD98845.1"

            "Hypothetical membrane spanning protein"
            ""

OrgPattern -------------------------------------------------------------------- -----11-----1-----------------------------------1--------------1-------1111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111-1-111----------------------------------------------------------------------------11------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------11-----------1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSGEEANSMLQSVMKHHHMQMPWHNFTPDNSNTPAKRATLKEKATLVGRVGIMLLSYGTG:Sequence : ==========:BL:SWS|51->292|YJJP_SHIFL|8e-06|23.9|226/256 : $$$$$$$$$$:RP:PFM|51->200|PF06738|1e-12|28.8|146/192|DUF1212 61: . . . * . .: 120 :AWRVRDSMNAIARELNISCSADVGLVSIEYTCVDEEGHGYTQALSLASTGVNTDKLSEME:Sequence :============================================================:BL:SWS|51->292|YJJP_SHIFL|8e-06|23.9|226/256 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->200|PF06738|1e-12|28.8|146/192|DUF1212 121: . . + . . .: 180 :QFVMDFNKGGSDLSSEQIHEILDEIERKPGHYTAIIAGLAAASACCAFVFLLGGGLVEML:Sequence : XXXXXXXXXXXXXX :SEG|154->167|aiiaglaaasacca :============================================================:BL:SWS|51->292|YJJP_SHIFL|8e-06|23.9|226/256 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|51->200|PF06738|1e-12|28.8|146/192|DUF1212 181: . * . . . .: 240 :CSFVGAGFGNYIRRKMIERRITLLACVSVSVAVACIFYLIAFKSLVAIMHVSLQHEAGYI:Sequence : XXXXXXXXXXX :SEG|205->215|acvsvsvavac :============================================================:BL:SWS|51->292|YJJP_SHIFL|8e-06|23.9|226/256 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|51->200|PF06738|1e-12|28.8|146/192|DUF1212 241: + . . . . *: 300 :GAMLFVIPGFPFITSGLDIAKLDMRSGLERMMYAIMIITVATLVGWVVAMAVHLKPVNFI:Sequence :==================================================== :BL:SWS|51->292|YJJP_SHIFL|8e-06|23.9|226/256 301: . . . . + .: 360 :PLDLGVIPMMLLRIPASFVGVFGFSIMFNSTIEMATWAGIIGAIANTLRLELVDLTNIPA:Sequence : X:SEG|360->375|agaaaftaalvaglla 361: . . . * . .: 420 :GAAAFTAALVAGLLASLIKGYPRISLTVPSIVIMVPGLYMYRAVYNIGVASINVGATWLT:Sequence :XXXXXXXXXXXXXXX :SEG|360->375|agaaaftaalvaglla 421: . . + . . .: 480 :EAALIVMFLPLGLITARILTDKKWRYKD :Sequence