[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD98845.1 lsal0 ABD98845.1 "Hypothetical membrane spanning protein"
MSGEEANSMLQSVMKHHHMQMPWHNFTPDNSNTPAKRATLKEKATLVGRVGIMLLSYGTG
AWRVRDSMNAIARELNISCSADVGLVSIEYTCVDEEGHGYTQALSLASTGVNTDKLSEME
QFVMDFNKGGSDLSSEQIHEILDEIERKPGHYTAIIAGLAAASACCAFVFLLGGGLVEML
CSFVGAGFGNYIRRKMIERRITLLACVSVSVAVACIFYLIAFKSLVAIMHVSLQHEAGYI
GAMLFVIPGFPFITSGLDIAKLDMRSGLERMMYAIMIITVATLVGWVVAMAVHLKPVNFI
PLDLGVIPMMLLRIPASFVGVFGFSIMFNSTIEMATWAGIIGAIANTLRLELVDLTNIPA
GAAAFTAALVAGLLASLIKGYPRISLTVPSIVIMVPGLYMYRAVYNIGVASINVGATWLT
EAALIVMFLPLGLITARILTDKKWRYKD
//