[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD98930.1"

            "Spermidine/putrescine transport ATP-binding protein potA"
POTA_LACS1  "RecName: Full=Spermidine/putrescine import ATP-binding protein potA;         EC=3.6.3.31;"

OrgPattern aaLDUPMOcbbWbWdTqMYVSUTb*QVosdlZLEFEGFJHJHFYcVcsOS**oATkUYcQXOLIe2AA ae*T*knlvvzfjYcZdSR-RpDDd*SSSSSS*vww****b*g****j*wnW***TVpGG***p******iigff*hgoU*qwCCEBCabXP8QGKN--JKZOOOoTdWXABBBBBBEEDDDDDKWTOVdRQZYgXx****ONN*d*x**ssriobdTRSORMooft***iOVKPOPNUNPKOtgjVT*rBek*************************kv***r*********cqrtstqoqsqqqrqelggj*qim**nVmet**VV**jbVfqsporwx***x******zzyu**x*zghgffhijkjifg**ylklxwzuz***********o*q****fppm**o***v*WO***peijsUdpkxxRljhQhbWWPOPOLQib***iZz****************-y**ro*x***XG**************NNS**********YXYYYYYY*ioOXph*88688888667ACADEBDDCCCBBB97B7NGHLGJ************************y********CQ****y*ty******ivtTYPXrhMNNMPNMVVXexph**Wmd*tYu*jhwOiifaYhpaghhhk**b*RPOTIPPPRPKCEEFEEFEEKYHJMVU*w*U*amNYS*WbefbTbhbZZbZdhfdjd5-GNbVN331544****e************-************************xtnyvswvyxyyxtwywwu**x*****b6************55MKGJFGHQRTRVQ*w*jjieigOTXTSZUZlPRVVRJXKTX*n*************s***HGGEGIGGGQnvt***********ZZXTUUTTVWIHHHA8TXWWOPQQBCABAAAB*FgFEEEJ-HHHFNJGUTPDJSFLKBBCit*dcz**zxGnS 4478zsQ1qPCFepWPNPKPRWRcNYUMNHJHJTSQGQLNKMLIHGPPPZXUlaNOTGIKKKGDI9GB3DE7FHLEH3GJEEEBHL8B-RjHNLOPFDGOI8KSSSBa*y*hpgzlqSLLIQgR**M*N**w4*a*PQKHoIP*iITNMIiHG*LfUV*Qw*X*YlL*mu*orxYKUMP*NQMUW****M**WU****j -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATS:Sequence : ========================================================:RP:SCP|5->240|1b0uA|1e-54|30.8|234/258|c.37.1.12 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 : $$$$$$$$$$$$$$$:RP:PFM|46->165|PF00005|5e-27|52.1|119/123|ABC_tran 61: . . . * . .: 120 :GDVYFDGKRINDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEA:Sequence :============================================================:RP:SCP|5->240|1b0uA|1e-54|30.8|234/258|c.37.1.12 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|46->165|PF00005|5e-27|52.1|119/123|ABC_tran 121: . . + . . .: 180 :LRMVRLDGYEDRAISEMSGGQRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELR:Sequence : ############### :PROS|137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|5->240|1b0uA|1e-54|30.8|234/258|c.37.1.12 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->165|PF00005|5e-27|52.1|119/123|ABC_tran 181: . * . . . .: 240 :SLQKKLGITFIFITHDQEEALAMSDEIFVLNNGNIVQSGTPVDIYDEPINHYVADFIGES:Sequence :============================================================:RP:SCP|5->240|1b0uA|1e-54|30.8|234/258|c.37.1.12 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 241: + . . . . *: 300 :NIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPEDLVLTSPEKGQLKVKVDTQL:Sequence :============================================================:RP:SCP|241->345|3d31A1|8e-14|22.1|104/119|b.40.6.3 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 301: . . . . + .: 360 :FRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESEEDFDARLDSY:Sequence :============================================= :RP:SCP|241->345|3d31A1|8e-14|22.1|104/119|b.40.6.3 :============================================================:BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362 361: . . . * . .: 420 :ND :Sequence :== :BL:SWS|1->362|POTA_LACS1|0.0|100.0|362/362