[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD98930.1 lsal0 ABD98930.1 "Spermidine/putrescine transport ATP-binding protein potA"
MKQPLISFKHVVKSYDDDVQVLKDVSFDIEEGKFYTLLGPSGCGKTTILNIIAGLSDATS
GDVYFDGKRINDVPANKRQVNTVFQDYALFQHLNVYDNIAFGLKIKKVPADKIKEKVTEA
LRMVRLDGYEDRAISEMSGGQRQRVAIARAIVLDPKVLLLDEPLSALDQKLRAEMQYELR
SLQKKLGITFIFITHDQEEALAMSDEIFVLNNGNIVQSGTPVDIYDEPINHYVADFIGES
NIVNGIMIKDELVEFAGQQFPCVDGGMKPNEPVEVVIRPEDLVLTSPEKGQLKVKVDTQL
FRGVHYEIRCTDALGNKWLVHSTKRAVPGENIGLSFGPEDIHVMRFNESEEDFDARLDSY
ND
//