[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD98951.1"

            "NAD(P)H-dependent quinone reductase"
            ""

OrgPattern --------------------------------------------1----------------------2 ------------------------------------------------------------------------------------2------------------1-------------------------------------------11111-1111-------11----1------------11-------144444442414344431122344431-14-32111111452--------------122222---22--1-133--22-1----22311111111221111-11111111111111111111--111---1---111111111-1-----------------------------111---11-1---------------------------------------1-------11-----------1---------------------12-----------------------------------------------------------------1------1-1--------1-1---11--111-1-------------11111--1-11---------------------1--1-111111---------12-111------1---1--111111-----------1-------------1-------------------------------------------111111-1111111111------------------------1------------2-1111--------1---222221---1--1111---------1--1----------1-----------------------------1-----------------11111---------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTNFKNNDFESVMLGRHSVRKFDTSVKIPREELKEMVANAITAPSACNLQAWHFIVVDTP:Sequence : HcHHHHHHHHHcccccccccccccccHHHHHHHHHHTTcccGGGcccEEEEEEccH:Sec Str : ====================================================:RP:SCP|9->212|2b67A1|4e-42|26.4|197/201|d.90.1.1 : ========================================================:BL:SWS|5->214|YDGI_BACSU|3e-43|41.5|207/209 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->191|PF00881|5e-14|37.3|153/157|Nitroreductase 61: . . . * . .: 120 :EGKDKLRSFFMKFNLPQLETSSAIVMLFGDTLAFKKYRALWENIYEQKQISKEELDRILN:Sequence :HHHHHHHHTTcTTTcTHHHHccEEEEEEEETTGGGGHHHHHHHHHHTTcccHHHHHHHHH:Sec Str :============================================================:RP:SCP|9->212|2b67A1|4e-42|26.4|197/201|d.90.1.1 :============================================================:BL:SWS|5->214|YDGI_BACSU|3e-43|41.5|207/209 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->191|PF00881|5e-14|37.3|153/157|Nitroreductase 121: . . + . . .: 180 :TFLPLYENADKQLLTADAMVDSSLAAMQFMLAARAHGYDTNPIAGYDAKKAATALGLDPE:Sequence :HHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEcGcccHHHHHHHHTcTcT:Sec Str :============================================================:RP:SCP|9->212|2b67A1|4e-42|26.4|197/201|d.90.1.1 :============================================================:BL:SWS|5->214|YDGI_BACSU|3e-43|41.5|207/209 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->191|PF00881|5e-14|37.3|153/157|Nitroreductase 181: . * . . . .: 240 :RYVPVMAIAVGKADSQSTDIKSTRYSVDDVIEFQ :Sequence :TEEEEEEEEcccGGGcccccccccccGGGTcccc :Sec Str :================================ :RP:SCP|9->212|2b67A1|4e-42|26.4|197/201|d.90.1.1 :================================== :BL:SWS|5->214|YDGI_BACSU|3e-43|41.5|207/209 :$$$$$$$$$$$ :RP:PFM|16->191|PF00881|5e-14|37.3|153/157|Nitroreductase