[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99073.1"

            "Hypothetical protein, phage associated"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKRIAEFKDAKGQFVKRYDKLVDKDGIQYMVSEHHDRYLVLVSLSDVRPPMPVIPSDLK:Sequence : EcccccccEEEEEEEccccTTTTcccccTTcHHHHHHHHTTcEETTEEcccGGGG:Sec Str 61: . . . * . .: 120 :NDYVKVG :Sequence :cccH :Sec Str