[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99073.1 lsal0 ABD99073.1 "Hypothetical protein, phage associated"
MKKRIAEFKDAKGQFVKRYDKLVDKDGIQYMVSEHHDRYLVLVSLSDVRPPMPVIPSDLK
NDYVKVG
//