[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "lsal0:ABD99183.1"

            "Conserved hypothetical protein"
Y370_LACS1  "RecName: Full=UPF0374 protein LSL_0370;"

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111111112111111111111111111111-1-11--1-111--1111111111111111111111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------11-11-----1-1-11111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWIT:Sequence : EEEEETTEEEEEEcTTcEEEEEEETTcccGGGccHHHHTTccEEEEEEEcccc :Sec Str :============================================================:BL:SWS|1->181|Y370_LACS1|e-110|100.0|181/181 61: . . . * . .: 120 :REPALVYFHKHYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKR:Sequence : cEEEEEcTTccEEEEEEEETTEEEEEEEEcccEEETTEEEEcEEEEEEEEcTTccEE:Sec Str :============================================================:BL:SWS|1->181|Y370_LACS1|e-110|100.0|181/181 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->126|PF04167|2e-14|55.6|63/71|DUF402 121: . . + . . .: 180 :LLDVDEYEDHGNKWHYSADIDKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSRQ:Sequence :EEcHHHHHHH HHTTccHHHHHHHHHHHHHHHHHHHHTcTTGG GTGGGcccc :Sec Str :============================================================:BL:SWS|1->181|Y370_LACS1|e-110|100.0|181/181 :$$$$$$ :RP:PFM|64->126|PF04167|2e-14|55.6|63/71|DUF402 181: . * . . . .: 240 :Q :Sequence : :Sec Str := :BL:SWS|1->181|Y370_LACS1|e-110|100.0|181/181