[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ABD99183.1 lsal0 ABD99183.1 "Conserved hypothetical protein"
MMNISGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENALIGCNDHTLVTESDGRRWIT
REPALVYFHKHYWFNIVTMIRENGVSYYCNLASPAVLDKEALKYIDYDLDVKVFPNGEKR
LLDVDEYEDHGNKWHYSADIDKILKHNVRVLVDWINNGKGPFSKEYVEIWYNRYLELSRQ
Q
//